Property Summary

NCBI Gene PubMed Count 26
Grant Count 372
R01 Count 218
Funding $56,182,625.18
PubMed Score 662.10
PubTator Score 122.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 2.274 0.005
cutaneous lupus erythematosus 1.800 0.000
glioblastoma 2.300 0.000
juvenile dermatomyositis 1.877 0.000
tuberculosis 1.400 0.000
primary pancreatic ductal adenocarcinoma 1.020 0.009
sarcoidosis 1.100 0.024
interstitial cystitis 1.500 0.002
cystic fibrosis 1.100 0.006
sonic hedgehog group medulloblastoma 1.100 0.002
primary Sjogren syndrome 1.800 0.003
lung carcinoma -1.200 0.000
progressive supranuclear palsy -1.200 0.008
ovarian cancer 2.600 0.000
dermatomyositis 2.100 0.002

Synonym

Accession P28838 B3KMQ3 Q6IAM6 Q6P0L6 Q9UQE3
Symbols LAP
PEPS
LAPEP
HEL-S-106

Gene

 GO Process (1)

Gene RIF (6)

PMID Text
25453285 LAP3 might be a new prognostic factor and be close correlation with glioma cell growth, migration, invasion.
25120751 our results indicated that up-regulated expression of LAP3 might contribute to the proliferation and metastasis of hepatocellular carcinoma
24477662 Overexpression of leucine aminopeptidase 3 contributes to malignant development of human esophageal squamous cell carcinoma.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16513116 results suggest that Lys528 is important for maximal activity of adipocyte-derived LAP by maintaining the appropriate structure of the substrate pocket of the enzyme

AA Sequence

MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET      1 - 70
LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV     71 - 140
EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM    141 - 210
TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV    211 - 280
GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV    281 - 350
RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE    351 - 420
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD    421 - 490
EVPYLRKGMTGRPTRTLIEFLLRFSQDNA                                             491 - 519
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25453285 2015 LAP3 promotes glioma progression by regulating proliferation, migration and invasion of glioma cells.
25120751 2014 Expression of leucine aminopeptidase 3 (LAP3) correlates with prognosis and malignant development of human hepatocellular carcinoma (HCC).
24477662 2014 Overexpression of leucine aminopeptidase 3 contributes to malignant development of human esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...