Property Summary

Ligand Count 32
NCBI Gene PubMed Count 26
PubMed Score 385.71
PubTator Score 122.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 5.0e-04
cystic fibrosis 1.100 6.1e-03
dermatomyositis 2.100 1.8e-03
glioblastoma 1.100 1.1e-05
interstitial cystitis 1.500 1.6e-03
juvenile dermatomyositis 1.877 4.0e-10
lung carcinoma -1.200 8.5e-19
Multiple myeloma 2.274 4.9e-03
ovarian cancer -1.600 3.7e-03
primary pancreatic ductal adenocarcinoma 1.020 9.0e-03
primary Sjogren syndrome 1.800 3.4e-03
progressive supranuclear palsy -1.200 7.7e-03
sarcoidosis 1.100 2.4e-02
sonic hedgehog group medulloblastoma 1.100 2.3e-03
tuberculosis 1.400 1.2e-04

Gene RIF (6)

AA Sequence

MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET      1 - 70
LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV     71 - 140
EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM    141 - 210
TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV    211 - 280
GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV    281 - 350
RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE    351 - 420
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD    421 - 490
EVPYLRKGMTGRPTRTLIEFLLRFSQDNA                                             491 - 519
//

Text Mined References (32)

PMID Year Title