Property Summary

NCBI Gene PubMed Count 47
Grant Count 3
Funding $31,785
PubMed Score 68.80
PubTator Score 36.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -2.438 0.000
group 4 medulloblastoma -2.500 0.000
medulloblastoma, large-cell -2.700 0.001
non-small cell lung cancer -2.165 0.000
lung cancer -1.600 0.000
breast carcinoma -1.500 0.000
fibroadenoma -1.600 0.022
lung adenocarcinoma -1.800 0.000
adult high grade glioma -1.800 0.000
ductal carcinoma in situ -1.600 0.001
invasive ductal carcinoma -2.200 0.001
ulcerative colitis 1.800 0.000
ovarian cancer 1.200 0.011

Synonym

Accession P28827 A7MBN1 D3DUH8 J3QL11 Protein-tyrosine phosphatase mu
Symbols RPTPM
RPTPU
PTPRL1
hR-PTPu
R-PTP-MU

Gene

PDB

1RPM   2C9A   2V5Y  

Gene RIF (17)

PMID Text
24771611 Study determined that, in addition to the furin-processed form of PTPmicro, a pool of 200 kDa full-length PTPmicro exists at the plasma membrane that is cleaved directly by ADAM to generate a larger shed form of the PTPmicro extracellular segment.
23185569 Decreased expression of PTPRM in breast cancer is correlated with poor prognosis and inversely correlated with disease-free survival.
22505657 Loss of PTPmu by proteolysis causes glioblastoma.
21743492 Results suggest that miR-221 and -222 regulate glioma tumorigenesis at least in part through the control of PTPmu protein expression.
21649524 In A549 cells, diverse injurious stimuli dramatically reduced PTPmu protein expression.
20659327 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRGLGTCLATLAGLLLTAAGETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSDPWMPSGSFML      1 - 70
VNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKVNNGPLGNPIWNISGDPTRTW     71 - 140
NRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGHPCTRTPHFLRIQNVEVNAGQFATFQCSAIG    141 - 210
RTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKE    211 - 280
PPVPIAPPQLASVGATYLWIQLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYE    281 - 350
ISVLLTRPGEGGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC    351 - 420
YQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDEDLPGAVPTESI    421 - 490
QGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVSKLGNETHFLFFGLYPGTTYS    491 - 560
FTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQTDNTVTVMLKPAHSRGAPVSVYQIVVEEERP    561 - 630
RRTKKTTEILKCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPYKSYRI    631 - 700
YFQAASRANGETKIDCVQVATKGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLA    701 - 770
KKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY    771 - 840
YPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEG    841 - 910
QSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYIDGYHRPNHYIATQGPMQETIY    911 - 980
DFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGVHEI    981 - 1050
REIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPSAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGV   1051 - 1120
VDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEF   1121 - 1190
RTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVT   1191 - 1260
QHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRI   1261 - 1330
YNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFC   1331 - 1400
AISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNSG                     1401 - 1452
//

Text Mined References (51)

PMID Year Title
24771611 2014 A protease storm cleaves a cell-cell adhesion molecule in cancer: multiple proteases converge to regulate PTPmu in glioma cells.
24583629 2014 Genome-wide analysis of methotrexate pharmacogenomics in rheumatoid arthritis shows multiple novel risk variants and leads for TYMS regulation.
23185569 2012 Protein tyrosine phosphatase µ (PTP µ or PTPRM), a negative regulator of proliferation and invasion of breast cancer cells, is associated with disease prognosis.
22505657 2012 Protein tyrosine phosphatase mu regulates glioblastoma cell growth and survival in vivo.
21743492 2012 miR-221/222 overexpession in human glioblastoma increases invasiveness by targeting the protein phosphate PTP?.
21649524 2011 Diverse injurious stimuli reduce protein tyrosine phosphatase-? expression and enhance epidermal growth factor receptor signaling in human airway epithelia.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20659327 2010 Trait-stratified genome-wide association study identifies novel and diverse genetic associations with serologic and cytokine phenotypes in systemic lupus erythematosus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...