Property Summary

NCBI Gene PubMed Count 322
Grant Count 484
R01 Count 128
Funding $200,236,639.27
PubMed Score 1056.77
PubTator Score 940.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.400 0.023
ependymoma 1.200 0.006
oligodendroglioma 1.200 0.005
psoriasis 2.900 0.000
glioblastoma 1.500 0.004
atypical teratoid / rhabdoid tumor 1.300 0.000
Duchenne muscular dystrophy 1.013 0.000
juvenile dermatomyositis 1.071 0.000
tuberculosis 1.200 0.000
diabetes mellitus -1.100 0.013
pediatric high grade glioma 1.200 0.001
pilocytic astrocytoma 1.100 0.000
non primary Sjogren syndrome sicca 1.100 0.044
invasive ductal carcinoma 1.320 0.001
lung carcinoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.131 0.028
ovarian cancer 1.900 0.000

Synonym

Accession P28799 D3DX55 P23781 P23782 P23783 P23784 Q53HQ8 Q53Y88 Q540U8 Q9BWE7 Q9H8S1 Q9UCH0
Symbols GEP
GP88
PEPI
PGRN
CLN11
PCDGF

Gene

GRN

PDB

1G26   2JYE   2JYT   2JYU   2JYV  

Gene RIF (315)

PMID Text
27100392 Mutations in granulin are the genetic causes of frontotemporal lobar degeneration.
26682689 Our findings do not support a diagnostic value of CSF PGRN in neurodegenerative diseases. Our data confirm that levels of PGRN in plasma do not reflect accurately levels in CSF in cognitively normal controls.
26674655 In contrast with TBK1 carriers, Belgian GRN carriers were more often diagnosed with the language variant than the behavioral variant in frontotemporal dementia patients.
26607602 that progranulin could promote invasiveness of epithelial ovarian cancer cells through an epithelial mesenchymal transition program directly
26600492 We investigated the effect of progranulin (PGRN) expression on the proliferation and senescence of cervical cancer cells
26509463 Progranulin CSF concentrations and CSF/serum progranulin ratio were significantly higher in patients with infectious diseases, with disturbed BBB function and with elevated CSF cell count and presence of oligoclonal bands.
26473392 GRN mutated FTD patients were older at death and more likely to present with non-fluent aphasia. They had TDP-43 pathology.
26370502 Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.
26339140 The study demonstrates increased PGRN expression at local sites of inflammation and association between PGRN levels, disease activity, and functional impairment in patients with Rheumatoid Arthritis.
26245842 Progranulin overproduction due to Fli-1 deficiency may contribute to the constitutive activation of SSc dermal fibroblasts by antagonizing the antifibrotic effect of TNF.
More...

AA Sequence

MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAG      1 - 70
HSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCC     71 - 140
VMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPD    141 - 210
ARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVG    211 - 280
DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPA    281 - 350
HLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGS    351 - 420
EIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNV    421 - 490
KARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCP    491 - 560
AGFRCAARGTKCLRREAPRWDAPLRDPALRQLL                                         561 - 593
//

Text Mined References (323)

PMID Year Title
27100392 2016 Characterization of Movement Disorder Phenomenology in Genetically Proven, Familial Frontotemporal Lobar Degeneration: A Systematic Review and Meta-Analysis.
26682689 2016 Progranulin Protein Levels in Cerebrospinal Fluid in Primary Neurodegenerative Dementias.
26674655 2016 Clinical features of TBK1 carriers compared with C9orf72, GRN and non-mutation carriers in a Belgian cohort.
26607602 2016 PGRN promotes migration and invasion of epithelial ovarian cancer cells through an epithelial mesenchymal transition program and the activation of cancer associated fibroblasts.
26600492 2015 Effect of progranulin (PGRN) on the proliferation and senescence of cervical cancer cells.
26509463 2016 Quantification and regulation of the adipokines resistin and progranulin in human cerebrospinal fluid.
26473392 2015 Distinct clinical and pathological phenotypes in frontotemporal dementia associated with MAPT, PGRN and C9orf72 mutations.
26370502 2015 Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.
26339140 2015 Progranulin Is Associated with Disease Activity in Patients with Rheumatoid Arthritis.
26245842 2015 Progranulin Overproduction Due to Fli-1 Deficiency Contributes to the Resistance of Dermal Fibroblasts to Tumor Necrosis Factor in Systemic Sclerosis.
More...