Property Summary

NCBI Gene PubMed Count 94
PubMed Score 385.93
PubTator Score 200.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.218 2.9e-05
adult high grade glioma 1.500 2.2e-04
Astrocytoma, Pilocytic 1.500 1.9e-07
atypical teratoid / rhabdoid tumor 1.100 5.1e-03
gastric cancer 1.100 2.4e-03
glioblastoma 1.800 7.9e-09
group 3 medulloblastoma 1.100 3.9e-03
medulloblastoma, large-cell 1.200 2.6e-04
osteosarcoma -2.086 1.9e-03
primitive neuroectodermal tumor 1.800 2.5e-04
tuberculosis -1.100 1.3e-03

Protein-protein Interaction (1)

Gene RIF (30)

AA Sequence

MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLACSLYVACRKS      1 - 70
IIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKYE     71 - 140
PIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYHLLLCCLDLIF    141 - 210
ANAIMCPNRQDLLNPSFKGLPSDFHTADFTASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFD    211 - 280
RKILKGECLLDLSSFTDNSKAVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQAN    281 - 350
VEYNLQQHFEKKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSDQLINIFESCV    351 - 420
RNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDMSV    421 - 490
LLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEE    491 - 560
QILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSG    561 - 630
SLRRDMQPLSPISVHERYSSPTAGSAKRRLFGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQ    631 - 700
TLLTMATAPVTGTTGHKVTIPLHGVANDAGEITLIPLSMNTNQESKVKSPVSLTAHSLIGASPKQTNLTK    701 - 770
AQEVHSTGINRPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL    771 - 840
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNINDDFEMIDCDLE    841 - 910
DATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRIS    911 - 980
QQHSIYISPHKNGSGLTPRSALLYKFNGSPSKSLKDINNMIRQGEQRTKKRVIAIDSDAESPAKRVCQEN    981 - 1050
DDVLLKRLQDVVSERANH                                                       1051 - 1068
//

Text Mined References (99)

PMID Year Title