Property Summary

NCBI Gene PubMed Count 209
Grant Count 120
R01 Count 77
Funding $12,992,625.08
PubMed Score 296.82
PubTator Score 283.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P28715 A6NGT4 Q5JUS4 Q5JUS5 Q7Z2V3 Q8IZL6 Q8N1B7 Q9HD59 Q9HD60
Symbols XPG
UVDR
XPGC
COFS3
ERCM2
ERCC5-201

Gene

PDB

5EKF   5EKG  

 GO Component (2)

Gene RIF (176)

PMID Text
26833090 Results show that XPG partners with BRCA1 and BRCA2 to maintain genomic stability through homologous recombination, and its loss causes DNA breaks, chromosome aberrations, and replication fork stalling.
26411687 Helicobacter Pylori introduces double-stranded DNA breaks by the nucleotide excision repair endonucleases XPF and XPG, which, together with RelA, are recruited to chromatin in a highly coordinated, type IV secretion system-dependent manner.
26338418 Individuals that harbor uORF1 of ERCC5 have a marked resistance to platinum-based agents
26225711 ERCC5 rs17655 polymorphism might contribute to genetic susceptibility to colorectal cancer.
26149386 The results suggest that the XPG-TFIIH complex is involved in transcription elongation and that defects in this association may partly account for Cockayne syndrome in xeroderma pigmentosum group G/Cockayne Syndrome patients.
26045839 our study indicated that ERCC5 rs2094258 polymorphism may contribute to the risk of breast cancer.
25987016 XPG Asp1104His polymorphism is a risk factor for head and neck cancer susceptibility.
25835182 It has been found that the genotype 751Gln/Gln and allele Gln of ERCC2 gene and allele Asp of 312Asn/Asp polymorphism of ERCC2 gene may be associated with an increased risk of colorectal cancer.
25729984 the rs2296147 and rs2094258 polymorphisms of XPG, could be used as surrogate markers, leading to individualization of non-small cell lung cancer treatment strategies.
25483071 CDT2 mediated XPG elimination from DNA damage sites clears the chromatin space needed for repair.
More...

AA Sequence

MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFHRLCKLLFFRI      1 - 70
RPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIKTAFRSKRDEALPSLTQVRRE     71 - 140
NDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFFHNPQAIDIESEDFSSLPPEVKHEILTDMKE    141 - 210
FTKRRRTLFEAMPEESDDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRR    211 - 280
VVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQA    281 - 350
ALLGSSSEEELESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMR    351 - 420
INSSTENSDEGLKVRDGKGIPFTATLASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVHVGTEAFPISD    421 - 490
ESMIKDRKDRLPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHAEVLEQQNELCPYESKFDSSL    491 - 560
LSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNVENVVSFNAKEHENFLETIQEQQTTESAGQD    561 - 630
LISIPKAVEPMEIDSEESESDGSFIEVQSVISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESL    631 - 700
LRDNSERDDVDGEPQEAEKDAEDSLHEWQDINLEELETLESNLLAQQNSLKAQKQQQERIAATVTGQMFL    701 - 770
ESQELLRLFGIPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDF    771 - 840
HNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQKNPKIRPNPH    841 - 910
DTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPV    911 - 980
LKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDK    981 - 1050
AKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAK   1051 - 1120
EPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT       1121 - 1186
//

Text Mined References (213)

PMID Year Title
26833090 2016 Non-catalytic Roles for XPG with BRCA1 and BRCA2 in Homologous Recombination and Genome Stability.
26411687 2015 H. pylori-Induced DNA Strand Breaks Are Introduced by Nucleotide Excision Repair Endonucleases and Promote NF-?B Target Gene Expression.
26338418 2015 A common polymorphism in the 5' UTR of ERCC5 creates an upstream ORF that confers resistance to platinum-based chemotherapy.
26225711 2015 Genetic Association between ERCC5 rs17655 Polymorphism and Colorectal Cancer Risk: Evidence Based on a Meta-analysis.
26149386 2015 Regulation of Transcription Elongation by the XPG-TFIIH Complex Is Implicated in Cockayne Syndrome.
26045839 2015 Association between ERCC5 gene polymorphisms and breast cancer risk.
25987016 2015 Genetic Association between the XPG Asp1104His Polymorphism and Head and Neck Cancer Susceptibility: Evidence Based on a Meta-Analysis.
25835182 2015 An association of selected ERCC2 and ERCC5 genes polymorphisms, the level of oxidative DNA damage and its repair efficiency with a risk of colorectal cancer in Polish population.
25729984 2015 XPG polymorphisms are associated with prognosis of advanced non-small cell lung cancer treated with platinum-based doublet chemotherapy.
25483071 2015 Cdt2-mediated XPG degradation promotes gap-filling DNA synthesis in nucleotide excision repair.
More...