Property Summary

NCBI Gene PubMed Count 71
PubMed Score 49.67
PubTator Score 82.25

Knowledge Summary

Patent (4,592)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
osteosarcoma 7933 3.23711449610602E-5
oligodendroglioma 2849 0.00117237901132977
ependymoma 2514 0.0131867498204479
astrocytic glioma 2241 0.0190062725029586
subependymal giant cell astrocytoma 2287 0.0328571357671835
group 4 medulloblastoma 1875 0.0399645231797863
Disease Target Count Z-score Confidence
Wegener's granulomatosis 14 3.791 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.100 0.019
ependymoma 1.500 0.013
oligodendroglioma 1.700 0.001
osteosarcoma 1.696 0.000
group 4 medulloblastoma 1.100 0.040
subependymal giant cell astrocytoma -1.383 0.033

Synonym

Accession P28702 P28703 Q59G65 Q5JP92 Q5STQ1
Symbols NR2B2
DAUDI6
RCoR-1
H-2RIIBP

Gene

PDB

1H9U   1UHL   5HJP   5I4V   5KYA   5KYJ  

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

Gene RIF (32)

PMID Text
26355550 Data show that pregnane X receptor/retinoid X receptor PXR/RXR-[alpha], RXR-[beta], or RXR-[gamma] expression was noted in 9 (16.4%), 9 (16.4%), and 10 (18.2%) pancreatic adenocarcinoma cases, respectively.
24183235 RXR interaction is necessary for NPM-RAR-mediated myeloid maturation arrest.
22322885 A fatty acid-binding protein 7/RXRbeta pathway enhances survival and proliferation in triple-negative breast cancer.
21923909 HIV-1 Nef induces loss of F-actin assembly and inhibits retinoid receptor-mediated transcription
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19888660 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19811264 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGR      1 - 70
DGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSM     71 - 140
GSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGD    141 - 210
RSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQ    211 - 280
RGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTL    281 - 350
VEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV    351 - 420
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLL    421 - 490
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA                               491 - 533
//

Text Mined References (75)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26355550 2015 Pregnane X Receptor Expression in Human Pancreatic Adenocarcinoma: Associations With Clinicopathologic Parameters, Tumor Proliferative Capacity, Patients' Survival, and Retinoid X Receptor Expression.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24183235 2013 Interaction with RXR is necessary for NPM-RAR-induced myeloid differentiation blockade.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
22322885 2012 A fatty acid-binding protein 7/RXR? pathway enhances survival and proliferation in triple-negative breast cancer.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...