Property Summary

NCBI Gene PubMed Count 71
PubMed Score 49.30
PubTator Score 82.25

Knowledge Summary

Patent (4,592)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.100 1.9e-02
ependymoma 1.500 1.3e-02
group 4 medulloblastoma 1.100 4.0e-02
oligodendroglioma 1.700 1.2e-03
osteosarcoma 1.088 2.3e-04
subependymal giant cell astrocytoma -1.383 3.3e-02

Gene RIF (32)

AA Sequence

MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGR      1 - 70
DGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSM     71 - 140
GSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGD    141 - 210
RSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQ    211 - 280
RGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTL    281 - 350
VEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV    351 - 420
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLL    421 - 490
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA                               491 - 533
//

Text Mined References (75)

PMID Year Title