Property Summary

NCBI Gene PubMed Count 32
PubMed Score 66.37
PubTator Score 49.50

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.42805941293597E-9
psoriasis 6685 8.16883321789153E-5
osteosarcoma 7933 4.21214684937602E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.6224299877571E-4
pediatric high grade glioma 2712 9.75385544624625E-4
glioblastoma 5572 0.00158758667200903
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00609198920413821


  Differential Expression (7)

Disease log2 FC p
psoriasis 1.600 0.000
osteosarcoma -1.502 0.000
glioblastoma -1.300 0.002
pancreatic ductal adenocarcinoma liver m... 1.506 0.001
intraductal papillary-mucinous adenoma (... 1.100 0.006
pediatric high grade glioma -1.100 0.001
ovarian cancer -1.500 0.000


Accession P28698 M0QXU0 Q7Z729 Q96I71 Q9NRY0 Q9UBW2 MZF-1
Symbols MZF-1




  Ortholog (7)

Gene RIF (24)

26010542 These findings suggest that PKCalpha expression in HCC could be stimulated by the formation of MZF-1/Elk-1 complex, which directly binds to the PKCalpha promoter.
25903835 Here we discuss the regulation of MZF1 that mediated its recruitment and activation in cancer, concentrating on posttranslational modification by phosphorylation, and sumoylation
25899830 our results argue that MZF-1 regulates the CTGF and NOV genes in the hematopoietic compartment, and may be involved in their respective functions in the stroma.
25884514 The aberrant decreases in Ik-1 and MZF1 contribute significantly to the pathogenesis of NPM-ALK(+) T-cell lymphoma through the upregulation of IGF-IR expression.
25877752 our results revealed that the loss of nuclear expression of MZF1 in oral squamous cell carcinoma (OSCC) samples can predict the progression of OSCC and the survival of OSCC patients in Taiwan
25425970 Data suggest that induction of foxhead box M1(FOXM1) by E6 oncoprotein through the transcription factors MZF1/NKX2-1 axis may be responsible for human papillomavirus 16/18-mediated tumor progression.
25284586 Data indicate that elevated miR-492 expression in prostate tumors that resulted in diminished myeloid zinc-finger 1 (MZF-1) and ferroportin (FPN).
25065746 MZF-1 binds to and positively regulates the GAPDH promoter.
24793789 MZF1-mediated MYC expression may promote tumor progression, resulting in poor outcomes in cases of lung adenocarcinoma with low-wild-type-LKB1 tumors.
23509792 p55PIK is transcriptionally activated by MZF1, resulting in increased proliferation of colorectal cancer cells

AA Sequence

RTHRREKPFACQDCGRRFHQSTKLIQHQRVHSAE                                        701 - 734

Text Mined References (35)

PMID Year Title
26010542 2015 MZF-1/Elk-1 Complex Binds to Protein Kinase C? Promoter and Is Involved in Hepatocellular Carcinoma.
25903835 2015 Role and Regulation of Myeloid Zinc Finger Protein 1 in Cancer.
25899830 2015 Myeloid Zinc Finger 1 (MZF-1) Regulates Expression of the CCN2/CTGF and CCN3/NOV Genes in the Hematopoietic Compartment.
25884514 2015 The transcription factors Ik-1 and MZF1 downregulate IGF-IR expression in NPM-ALK? T-cell lymphoma.
25877752 2015 Expression of myeloid zinc finger 1 and the correlation to clinical aspects of oral squamous cell carcinoma.
25425970 2014 Up-regulation of FOXM1 by E6 oncoprotein through the MZF1/NKX2-1 axis is required for human papillomavirus-associated tumorigenesis.
25284586 2015 Myeloid zinc-finger 1 (MZF-1) suppresses prostate tumor growth through enforcing ferroportin-conducted iron egress.
25065746 2014 The glyceraldehyde 3-phosphate dehydrogenase gene (GAPDH) is regulated by myeloid zinc finger 1 (MZF-1) and is induced by calcitriol.
24793789 2015 The MZF1/c-MYC axis mediates lung adenocarcinoma progression caused by wild-type lkb1 loss.
23509792 2013 p55PIK transcriptionally activated by MZF1 promotes colorectal cancer cell proliferation.