Property Summary

NCBI Gene PubMed Count 37
PubMed Score 73.20
PubTator Score 49.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.300 1.6e-03
intraductal papillary-mucinous adenoma (... 1.100 6.1e-03
osteosarcoma -1.502 4.2e-04
ovarian cancer -1.500 1.4e-09
pancreatic ductal adenocarcinoma liver m... 1.506 6.6e-04
pediatric high grade glioma -1.100 9.8e-04
psoriasis 1.600 8.2e-05

Gene RIF (29)

AA Sequence

MRPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFRYEEATGPQEALAQLRELCR      1 - 70
QWLRPEVRSKEQMLELLVLEQFLGALPPEIQARVQGQRPGSPEEAAALVDGLRREPGGPRRWVTVQVQGQ     71 - 140
EVLSEKMEPSSFQPLPETEPPTPEPGPKTPPRTMQESPLGLQVKEESEVTEDSDFLESGPLAATQESVPT    141 - 210
LLPEEAQRCGTVLDQIFPHSKTGPEGPSWREHPRALWHEEAGGIFSPGFALQLGSISAGPGSVSPHLHVP    211 - 280
WDLGMAGLSGQIQSPSREGGFAHALLLPSDLRSEQDPTDEDPCRGVGPALITTRWRSPRGRSRGRPSTGG    281 - 350
GVVRGGRCDVCGKVFSQRSNLLRHQKIHTGERPFVCSECGRSFSRSSHLLRHQLTHTEERPFVCGDCGQG    351 - 420
FVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPEPPGPFPCSEC    421 - 490
RESFARRAVLLEHQAVHTGDKSFGCVECGERFGRRSVLLQHRRVHSGERPFACAECGQSFRQRSNLTQHR    491 - 560
RIHTGERPFACAECGKAFRQRPTLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGEC    561 - 630
GLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHL    631 - 700
RTHRREKPFACQDCGRRFHQSTKLIQHQRVHSAE                                        701 - 734
//

Text Mined References (41)

PMID Year Title