Property Summary

NCBI Gene PubMed Count 24
PubMed Score 93.94
PubTator Score 59.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 7.45792492823324E-19
cystic fibrosis 1670 1.92593523853633E-7
ovarian cancer 8492 4.93973536501585E-7
hepatocellular carcinoma 550 1.98431774156081E-5
lung cancer 4473 4.90034423039517E-5
pancreatic cancer 2300 2.41968062518732E-4
pancreatic carcinoma 567 2.41968062518732E-4
medulloblastoma, large-cell 6234 7.11007998006532E-4
tuberculosis 1563 0.00105247047987289
gastric cancer 436 0.0021019959924428
dermatomyositis 967 0.00587299882454427
Pick disease 1893 0.00820875912403365
osteosarcoma 7933 0.0103259112652814
esophageal adenocarcinoma 737 0.0200190588680455
diabetes mellitus 1663 0.0296610502600242
progressive supranuclear palsy 674 0.0317719568934439
interstitial lung disease 292 0.032076268402654
Disease Target Count Z-score Confidence
Acromesomelic dysplasia 10 4.077 2.0
substance-induced psychosis 7 3.463 1.7

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.100 0.002
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.700 0.000
interstitial lung disease -1.200 0.032
esophageal adenocarcinoma 1.100 0.020
osteosarcoma -2.241 0.010
cystic fibrosis 2.887 0.000
medulloblastoma, large-cell -1.600 0.001
tuberculosis 1.500 0.001
non-small cell lung cancer -1.426 0.000
lung cancer -1.900 0.000
diabetes mellitus -1.300 0.030
pancreatic carcinoma 1.700 0.000
Pick disease -1.100 0.008
progressive supranuclear palsy -1.300 0.032
ovarian cancer -1.900 0.000
dermatomyositis 1.600 0.006

Synonym

Accession P28676 B2R5X3 Q53TB5 Q59EP3
Symbols GCL

Gene

GCA

PDB

1F4O   1F4Q   1K94   1K95  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (9)

PMID Text
26648480 Results indicate that heterodimerization of GCA and TLR9 is important for TLR9-mediated downstream signaling and might serve to fine tune processes against viral infection.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19156166 IFIH1-GCA-KCNH7 locus is not associated with genetic susceptibility to multiple sclerosis in French patients
19156166 Observational study of gene-disease association. (HuGE Navigator)
18285833 IFIH1 interferon induced helicase, GCA grancalcin or the potassium channel KCNH7 - are potential candidates implicated in the pathogenesis of multiple sclerosis.
18285833 Observational study of gene-disease association. (HuGE Navigator)
18071670 The reported type 1 diabetes association is from a linkage disequilibrium region including three candidate genes, FAP, IFIH1 and GCA.
12804766 GCA interacts with SRI in vivo and in vitro.

AA Sequence

MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDA      1 - 70
EELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVE     71 - 140
HHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDF    141 - 210
LQGTMAI                                                                   211 - 217
//

Text Mined References (26)

PMID Year Title
26648480 2016 Grancalcin (GCA) modulates Toll-like receptor 9 (TLR9) mediated signaling through its direct interaction with TLR9.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19156166 2009 IFIH1-GCA-KCNH7 locus is not associated with genetic susceptibility to multiple sclerosis in French patients.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...