Property Summary

NCBI Gene PubMed Count 24
PubMed Score 93.25
PubTator Score 59.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
cystic fibrosis 2.887 1.9e-07
dermatomyositis 1.600 5.9e-03
diabetes mellitus -1.300 3.0e-02
esophageal adenocarcinoma 1.100 2.0e-02
gastric cancer 1.100 2.1e-03
hepatocellular carcinoma 1.200 2.0e-05
interstitial lung disease -1.200 3.2e-02
lung cancer -1.900 4.9e-05
medulloblastoma, large-cell -1.600 7.1e-04
non-small cell lung cancer -1.426 7.5e-19
osteosarcoma -2.241 1.0e-02
ovarian cancer -1.900 4.9e-07
pancreatic cancer 1.700 2.4e-04
pancreatic carcinoma 1.700 2.4e-04
Pick disease -1.100 8.2e-03
progressive supranuclear palsy -1.300 3.2e-02
tuberculosis 1.500 1.1e-03

Gene RIF (9)

AA Sequence

MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDA      1 - 70
EELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVE     71 - 140
HHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDF    141 - 210
LQGTMAI                                                                   211 - 217
//

Text Mined References (26)

PMID Year Title