Property Summary

NCBI Gene PubMed Count 24
Grant Count 72
R01 Count 59
Funding $17,288,468.23
PubMed Score 93.94
PubTator Score 59.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.100 0.002
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.700 0.000
interstitial lung disease -1.200 0.032
esophageal adenocarcinoma 1.100 0.020
osteosarcoma -2.241 0.010
cystic fibrosis 2.887 0.000
medulloblastoma, large-cell -1.600 0.001
tuberculosis 1.500 0.001
non-small cell lung cancer -1.426 0.000
lung cancer -1.900 0.000
diabetes mellitus -1.300 0.030
pancreatic carcinoma 1.700 0.000
Pick disease -1.100 0.008
progressive supranuclear palsy -1.300 0.032
ovarian cancer -1.900 0.000
dermatomyositis 1.600 0.006

Synonym

Accession P28676 B2R5X3 Q53TB5 Q59EP3
Symbols GCL

Gene

GCA

PDB

1F4O   1F4Q   1K94   1K95  

Gene RIF (9)

PMID Text
26648480 Results indicate that heterodimerization of GCA and TLR9 is important for TLR9-mediated downstream signaling and might serve to fine tune processes against viral infection.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19156166 IFIH1-GCA-KCNH7 locus is not associated with genetic susceptibility to multiple sclerosis in French patients
19156166 Observational study of gene-disease association. (HuGE Navigator)
18285833 IFIH1 interferon induced helicase, GCA grancalcin or the potassium channel KCNH7 - are potential candidates implicated in the pathogenesis of multiple sclerosis.
18285833 Observational study of gene-disease association. (HuGE Navigator)
18071670 The reported type 1 diabetes association is from a linkage disequilibrium region including three candidate genes, FAP, IFIH1 and GCA.
12804766 GCA interacts with SRI in vivo and in vitro.

AA Sequence

MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDA      1 - 70
EELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVE     71 - 140
HHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDF    141 - 210
LQGTMAI                                                                   211 - 217
//

Text Mined References (26)

PMID Year Title
26648480 2016 Grancalcin (GCA) modulates Toll-like receptor 9 (TLR9) mediated signaling through its direct interaction with TLR9.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19156166 2009 IFIH1-GCA-KCNH7 locus is not associated with genetic susceptibility to multiple sclerosis in French patients.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...