Property Summary

NCBI Gene PubMed Count 23
PubMed Score 34.88
PubTator Score 31.27

Knowledge Summary

Patent (8,014)

TINX Plot

  Disease Sources (5)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 0.007
ependymoma -1.300 0.001
oligodendroglioma -1.200 0.003
diabetes mellitus 1.100 0.001
gastric carcinoma -1.300 0.014
psoriasis -2.200 0.000

Synonym

Accession P28566 E1P503 Q9P1Y1 5-HT-1E
Symbols 5-HT1E

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (1)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
571 screening 641 / 0 / 64284 Primary Cell Based High Throughput Screening Assay for Antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
574 screening 446 / 0 / 64479 Primary Cell Based High Throughput Screening Assay for Agonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
726 confirmatory 27 / 0 / 24 Dose Response Cell Based High Throughput Screening Assay for Agonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
749 confirmatory 24 / 0 / 20 Dose Response Cell Based Assay for Antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E
1516 confirmatory 11 / 0 / 20 Counterscreen assay for S1P3 antagonists: Dose response cell-based high throughput screening assay to identify antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
1675 summary 0 / 0 / 0 Summary of the probe development efforts to identify antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
1676 summary 0 / 0 / 0 Summary of the probe development efforts to identify agonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)

Gene RIF (8)

PMID Text
19455600 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18937842 Observational study of gene-disease association. (HuGE Navigator)
18821565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18079067 Observational study of gene-disease association. (HuGE Navigator)
12627464 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLL      1 - 70
VAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAA     71 - 140
LMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAK    141 - 210
SLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQ    211 - 280
ISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNED    281 - 350
FKLAFKKLIRCREHT                                                           351 - 365
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21422162 2011 Toward selective drug development for the human 5-hydroxytryptamine 1E receptor: a comparison of 5-hydroxytryptamine 1E and 1F receptor structure-affinity relationships.
20945968 2011 Serotonin receptors - from molecular biology to clinical applications.
19455600 2010 Association study of the serotoninergic system in migraine in the Spanish population.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18937842 2008 The influence of serotonin- and other genes on impulsive behavioral aggression and cognitive impulsivity in children with attention-deficit/hyperactivity disorder (ADHD): Findings from a family-based association test (FBAT) analysis.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
More...