Property Summary

NCBI Gene PubMed Count 23
PubMed Score 34.88
PubTator Score 31.27

Knowledge Summary

Patent (8,014)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 0.007
ependymoma -1.300 0.001
oligodendroglioma -1.200 0.003
diabetes mellitus 1.100 0.001
gastric carcinoma -1.300 0.014
psoriasis -2.200 0.000

Synonym

Accession P28566 E1P503 Q9P1Y1 5-HT-1E
Symbols 5-HT1E

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
571 screening 641 / 0 / 64284 Primary Cell Based High Throughput Screening Assay for Antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
574 screening 446 / 0 / 64479 Primary Cell Based High Throughput Screening Assay for Agonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
726 confirmatory 27 / 0 / 24 Dose Response Cell Based High Throughput Screening Assay for Agonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
749 confirmatory 24 / 0 / 20 Dose Response Cell Based Assay for Antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E
1516 confirmatory 11 / 0 / 20 Counterscreen assay for S1P3 antagonists: Dose response cell-based high throughput screening assay to identify antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
1675 summary 0 / 0 / 0 Summary of the probe development efforts to identify antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
1676 summary 0 / 0 / 0 Summary of the probe development efforts to identify agonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)

Gene RIF (8)

PMID Text
19455600 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18937842 Observational study of gene-disease association. (HuGE Navigator)
18821565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18079067 Observational study of gene-disease association. (HuGE Navigator)
12627464 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLL      1 - 70
VAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAA     71 - 140
LMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAK    141 - 210
SLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQ    211 - 280
ISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNED    281 - 350
FKLAFKKLIRCREHT                                                           351 - 365
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21422162 2011 Toward selective drug development for the human 5-hydroxytryptamine 1E receptor: a comparison of 5-hydroxytryptamine 1E and 1F receptor structure-affinity relationships.
20945968 2011 Serotonin receptors - from molecular biology to clinical applications.
19455600 2010 Association study of the serotoninergic system in migraine in the Spanish population.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18937842 2008 The influence of serotonin- and other genes on impulsive behavioral aggression and cognitive impulsivity in children with attention-deficit/hyperactivity disorder (ADHD): Findings from a family-based association test (FBAT) analysis.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
More...