Property Summary

Ligand Count 4
NCBI Gene PubMed Count 180
PubMed Score 810.93
PubTator Score 327.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (33)

Disease log2 FC p
acute quadriplegic myopathy 1.177 1.5e-03
adrenocortical carcinoma -1.178 3.7e-03
astrocytoma 2.000 5.6e-03
autosomal dominant Emery-Dreifuss muscul... 1.018 3.7e-02
Breast cancer -1.700 5.2e-07
chronic lymphosyte leukemia -2.000 2.9e-07
chronic rhinosinusitis -1.207 5.0e-02
colon cancer -2.500 1.3e-02
Down syndrome 1.100 8.5e-03
fibroadenoma -2.100 1.8e-02
gastric cancer -2.600 1.2e-03
glioblastoma 2.600 8.8e-04
hepatocellular carcinoma -1.500 1.3e-02
intraductal papillary-mucinous adenoma (... -1.800 2.4e-04
intraductal papillary-mucinous carcinoma... -2.100 7.3e-04
intraductal papillary-mucinous neoplasm ... -1.800 2.0e-03
limb girdle muscular dystrophy 2I 1.156 1.7e-03
lung adenocarcinoma -1.100 2.2e-09
lung cancer -2.300 9.2e-06
lung carcinoma -1.500 2.5e-12
malignant mesothelioma -1.500 4.4e-07
medulloblastoma, large-cell -1.200 1.4e-02
nasopharyngeal carcinoma -1.900 1.4e-03
non-small cell lung cancer -1.968 2.1e-23
ovarian cancer -1.700 8.6e-03
pancreatic cancer -2.400 4.8e-03
pancreatic carcinoma -2.400 4.8e-03
pituitary cancer -2.600 2.0e-07
psoriasis 1.800 1.4e-03
pterygium -1.600 3.1e-02
Rheumatoid arthritis 1.500 8.2e-04
urothelial carcinoma -2.900 1.8e-03
Waldenstrons macroglobulinemia 1.549 2.2e-02

 GO Component (2)

Gene RIF (162)

AA Sequence

MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAE      1 - 70
LRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQS     71 - 140
TPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANC    141 - 210
PNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVK    211 - 280
LDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHST    281 - 350
NSALSYLQSPITTSPSC                                                         351 - 367
//

Text Mined References (181)

PMID Year Title