Property Summary

NCBI Gene PubMed Count 165
Grant Count 352
R01 Count 220
Funding $49,748,612.4
PubMed Score 767.86
PubTator Score 327.89

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P28562 D3DQL9 Q2V508
Symbols HVH1
MKP1
CL100
MKP-1
PTPN10

Gene

 GO Component (2)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
374 screening 100 / 115 / 65024 In vitro Primary HTS Assay for MKP-1
442 confirmatory 6 / 0 / 0 In vitro MKP-1 Phosphatase Dose Response Confirmation and Secondary Selectivity/Specificity Assay
551 confirmatory 49 / 0 / 69 In vitro MKP-1 Phosphatase HTS Dose Response Confirmation Assay
558 confirmatory 33 / 0 / 25 In vitro MKP-1 Phosphatase Dose Response Active/Probe Assessment Assay - Effects of DTT
562 confirmatory 33 / 0 / 25 In vitro MKP-1 Phosphatase Dose Response Active/Probe Assessment Assay - Effects of Catalase
563 confirmatory 41 / 0 / 17 In vitro MKP-1 Phosphatase Dose Response Active/Probe Assessment Assay - Reproducibility testing
674 confirmatory 11 / 0 / 18 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment: MKP-1 Dose Response Selectivity comparison.

Gene RIF (148)

PMID Text
26769965 The heparin effects on TNFalpha-induced stress fiber formation and Map kinase signaling depend on increased DUSP1 expression.
26689986 In E1a expressing non-small cell lung carcinoma cells, upregulation of MKP1 and the subsequent p38MAPK inhibition is required for the induction of chemosensitivity to cisplatin.
26546680 DUSP1 overexpression and inhibition of MAPKs prevented IL1B-induced expression of ZFP36, this was associated with increased TNF mRNA expression at 6 h, an effect that was predominantly due to elevated transcription.
26329166 MKP-1 can attenuate tamoxifen-induced cell death through inhibiting the JNK signal pathway.
26280733 Progesterone acts via GR to drive MKP-1 expression, which in turn inhibits IL-1beta-dependent c-Jun activation and COX-2 expression.
26176177 evidence of association between depressive symptom severity and increasing serum MKP-1 levels in women, and decreasing T levels in perimenopausal women.
26158762 Data show that sorafenib inhibited microRNA miR-101 expression and enhanced dual specificity phosphatase 1 (DUSP1) expression and lowered transforming growth factor beta I (TGF-beta) release in M2 macrophage, slowing macrophage-driven hepatocarcinoma.
26111828 MKP1 recruits to the chromatin in response to DNA damage and correlates with the decrease of H3S10P, whereas MKP1 is released from chromatin during recovery phase of DNA damage response.
25943894 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of MKP-1
25872469 The proliferation of human cervical cancer cells was also inhibited by DUSP1
More...

AA Sequence

MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAE      1 - 70
LRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQS     71 - 140
TPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANC    141 - 210
PNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVK    211 - 280
LDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHST    281 - 350
NSALSYLQSPITTSPSC                                                         351 - 367
//

Text Mined References (166)

PMID Year Title
26769965 2016 Heparin Decreases in Tumor Necrosis Factor ? (TNF?)-induced Endothelial Stress Responses Require Transmembrane Protein 184A and Induction of Dual Specificity Phosphatase 1.
26689986 2015 MKP1 mediates chemosensitizer effects of E1a in response to cisplatin in non-small cell lung carcinoma cells.
26546680 2016 Negative Feed-forward Control of Tumor Necrosis Factor (TNF) by Tristetraprolin (ZFP36) Is Limited by the Mitogen-activated Protein Kinase Phosphatase, Dual-specificity Phosphatase 1 (DUSP1): IMPLICATIONS FOR REGULATION BY GLUCOCORTICOIDS.
26329166 2015 Mitogen-activated protein kinase phosphatase 1 is involved in tamoxifen resistance in MCF7 cells.
26280733 2015 Progesterone and the Repression of Myometrial Inflammation: The Roles of MKP-1 and the AP-1 System.
26176177 2016 Association Between MKP-1, BDNF, and Gonadal Hormones with Depression on Perimenopausal Women.
26158762 2015 MiR-101 targets DUSP1 to regulate the TGF-? secretion in sorafenib inhibits macrophage-induced growth of hepatocarcinoma.
26111828 2015 MKP1 phosphatase mediates G1-specific dephosphorylation of H3Serine10P in response to DNA damage.
25872469 2015 Production of DUSP1 protein using the baculovirus insect cell expression system and its in vitro effects on cancer cells.
25858560 2015 AMPK Suppresses Vascular Inflammation In Vivo by Inhibiting Signal Transducer and Activator of Transcription-1.
More...