Property Summary

NCBI Gene PubMed Count 1,536
Grant Count 595
R01 Count 403
Funding $43,485,866.96
PubMed Score 1138.14
PubTator Score 5685.03

Knowledge Summary

Patent (446,546)

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -1.100 0.029
psoriasis 1.900 0.000
osteosarcoma -1.625 0.001
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.400 0.000
Amyotrophic Lateral Sclerosis 1.070 0.000
juvenile dermatomyositis 1.079 0.000
tuberculosis and treatment for 6 months -1.100 0.003
Breast cancer 2.900 0.023
Pick disease -1.200 0.000
ovarian cancer -1.900 0.000

Synonym

Accession P28482 A8CZ64 MAP kinase 1
Symbols ERK
p38
p40
p41
ERK2
ERT1
ERK-2
MAPK2
PRKM1
PRKM2
P42MAPK
p41mapk
p42-MAPK

Gene

PDB

2Y9Q   1PME   1TVO   1WZY   2OJG   2OJI   2OJJ   3D42   3D44   3I5Z   3I60   3SA0   3TEI   3W55   4FMQ   4FUX   4FUY   4FV0   4FV1   4FV2   4FV3   4FV4   4FV5   4FV6   4FV7   4FV8   4FV9   4G6N   4G6O   4H3P   4H3Q   4IZ5   4IZ7   4IZA   4N0S   4NIF   4O6E   4QP1   4QP2   4QP3   4QP4   4QP6   4QP7   4QP8   4QP9   4QPA   4QTA   4QTE   4XJ0   4ZXT   4ZZM   4ZZN   4ZZO   5AX3   5BUE   5BUI   5BUJ   5BVD   5BVE   5BVF   5K4I   5LCJ   5LCK  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
995 confirmatory 711 / 5215 / 66078 qHTS Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay
1454 confirmatory 548 / 5992 / 126845 qHTS Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay; Stimulation with EGF
1724 confirmatory 40 / 46 / 27 Confirmation Concentration-Response Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay
1725 confirmatory 33 / 13 / 14 Confirmation Concentration-Response Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay; Stimulation with EGF
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588612 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Phosphorylated Mitogen-Activated Protein Kinase 1 (P-MAPK1; P-ERK1/2) protein levels in DLD1 cells
588614 other 0 / 0 / 3 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Mitogen-Activated Protein Kinase 1 (MAPK1; ERK1/2) protein levels in DLD1 cells
588642 other 0 / 0 / 3 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Mitogen-Activated Protein Kinase 1 (MAPK1; ERK1/2) protein levels in HCT116 human colorectal carcinoma cells
588643 other 2 / 0 / 1 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Phosphorylated Mitogen-Activated Protein Kinase 1 (P-MAPK1; P-ERK1/2) protein levels in HCT116 human colorectal carcinoma cells
588655 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Phosphorylated Mitogen-Activated Protein Kinase 1 (P-MAPK1; P-ERK1/2) protein levels in HT29 human colorectal carcinoma cells
More...

Gene RIF (1406)

PMID Text
27098723 the purpose of this paper was to investigate MAPK downstream signalling molecules in Natural killer cell phenotypes from Chronic Fatigue Syndrome/Myalgic Encephalomyelitis patients.
27083547 Human NHE1 acts as an ERK2 membrane protein scaffold in vivo that is necessary for ERK2 activation via direct interactions, and loss of scaffolding by NHE1 leads to decreased ERK2 activation.
26945151 The Asian-American variant of human papillomavirus type 16 exhibits higher activation of MAPK and PI3K/AKT signaling pathways, transformation, migration and invasion of primary human keratinocytes.
26930065 Studies indicate key feedback loops involved in the cross-talk among the insulin-proto-oncogene protein c-akt (AKT) and MAPK/ERK signaling pathways.
26867010 FXa inhibitor reduces the collagen-stimulated release of phosphorylated HSP27 from human platelets due to the inhibition of HSP27 phosphorylation via p44/p42 MAP kinase
26858456 Endocytosis separates EGF receptors from endogenous fluorescently labeled HRas and diminishes receptor signaling to MAP kinases in endosomes.
26823699 Oleanolic acid suppresses the proliferation of human bladder cancer by targeting Akt/mTOR/S6K and ERK1/2 signaling.
26795953 The results showed that PDGF-BB significantly increased PRMT1 expression after 1h lasting over 48h, through ERK1/2 MAPK and STAT1 signaling.
26774343 Collectively, these results suggest that Kazinol-E is a direct inhibitor of ERK1, and more studies are warranted to develop this reagent for therapeutic breast CSLC targeting.
26773499 The data provide the first evidence that SJP protects SH-SY5Y cells against 6-OHDA toxicity possibly by inhibiting MAPK and NF-kappaB and activating PI3K/Akt signaling pathways.
More...

AA Sequence

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLR      1 - 70
EIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYI     71 - 140
HSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID    141 - 210
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP    211 - 280
NADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEE    281 - 350
TARFQPGYRS                                                                351 - 360
//

Text Mined References (1573)

PMID Year Title