Property Summary

Ligand Count 769
NCBI Gene PubMed Count 1,658
PubMed Score 1239.37
PubTator Score 5685.03

Knowledge Summary

Patent (446,546)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0

Expression

  Differential Expression (14)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.070 3.8e-05
atypical teratoid / rhabdoid tumor -1.600 3.2e-04
Breast cancer 2.900 2.3e-02
esophageal adenocarcinoma -1.100 2.9e-02
glioblastoma -1.200 8.6e-05
group 3 medulloblastoma -1.300 8.3e-03
juvenile dermatomyositis 1.079 2.6e-13
medulloblastoma, large-cell -1.500 1.8e-04
osteosarcoma -1.625 5.8e-04
ovarian cancer -1.900 3.1e-08
Pick disease -1.200 4.2e-04
primitive neuroectodermal tumor -1.400 1.0e-04
psoriasis 1.900 3.1e-05
tuberculosis and treatment for 6 months -1.100 2.8e-03

Synonym

Accession P28482 A8CZ64 MAP kinase 1
Symbols ERK
p38
p40
p41
ERK2
ERT1
ERK-2
MAPK2
PRKM1
PRKM2
P42MAPK
p41mapk
p42-MAPK

Gene

 GWAS Trait (1)

Protein-protein Interaction (5)

PDB (74)

Gene RIF (1496)

AA Sequence

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLR      1 - 70
EIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYI     71 - 140
HSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID    141 - 210
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP    211 - 280
NADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEE    281 - 350
TARFQPGYRS                                                                351 - 360
//

Text Mined References (1695)

PMID Year Title