Property Summary

NCBI Gene PubMed Count 1,658
PubMed Score 1239.37
PubTator Score 5685.03

Knowledge Summary

Patent (446,546)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Multiple Sclerosis 527 0.0 3.0

Expression

  Differential Expression (14)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.070 3.8e-05
atypical teratoid / rhabdoid tumor -1.600 3.2e-04
Breast cancer 2.900 2.3e-02
esophageal adenocarcinoma -1.100 2.9e-02
glioblastoma -1.200 8.6e-05
group 3 medulloblastoma -1.300 8.3e-03
juvenile dermatomyositis 1.079 2.6e-13
medulloblastoma, large-cell -1.500 1.8e-04
osteosarcoma -1.625 5.8e-04
ovarian cancer -1.900 3.1e-08
Pick disease -1.200 4.2e-04
primitive neuroectodermal tumor -1.400 1.0e-04
psoriasis 1.900 3.1e-05
tuberculosis and treatment for 6 months -1.100 2.8e-03

Synonym

Accession P28482 A8CZ64 MAP kinase 1
Symbols ERK
p38
p40
p41
ERK2
ERT1
ERK-2
MAPK2
PRKM1
PRKM2
P42MAPK
p41mapk
p42-MAPK

Gene

PDB

2Y9Q   1PME   1TVO   1WZY   2OJG   2OJI   2OJJ   3D42   3D44   3I5Z   3I60   3SA0   3TEI   3W55   4FMQ   4FUX   4FUY   4FV0   4FV1   4FV2   4FV3   4FV4   4FV5   4FV6   4FV7   4FV8   4FV9   4G6N   4G6O   4H3P   4H3Q   4IZ5   4IZ7   4IZA   4N0S   4NIF   4O6E   4QP1   4QP2   4QP3   4QP4   4QP6   4QP7   4QP8   4QP9   4QPA   4QTA   4QTE   4XJ0   4ZXT   4ZZM   4ZZN   4ZZO   5AX3   5BUE   5BUI   5BUJ   5BVD   5BVE   5BVF   5K4I   5LCJ   5LCK   5NGU   5NHF   5NHH   5NHJ   5NHL   5NHO   5NHP   5NHV   5V60   5V61   5V62  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (1496)

AA Sequence

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLR      1 - 70
EIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYI     71 - 140
HSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID    141 - 210
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP    211 - 280
NADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEE    281 - 350
TARFQPGYRS                                                                351 - 360
//

Text Mined References (1695)

PMID Year Title