Property Summary

NCBI Gene PubMed Count 33
PubMed Score 53.86
PubTator Score 7.02

Knowledge Summary

Patent (1,150)

Expression

Gene RIF (15)

AA Sequence

MPYFTRLILFLFCLMVLVESRKPKRKRWTGQVEMPKPSHLYKKNLDVTKIRKGKPQQLLRVDEHDFSMRP      1 - 70
AFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLAFSSASNKSMTFDGRLVKKIWVPDVFF     71 - 140
VHSKRSFTHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNMDFSHFPLDSQTCSLELESYAYTDEDLMLYW    141 - 210
KNGDESLKTDEKISLSQFLIQKFHTTSRLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSW    211 - 280
VSFWIDRRAVPARVSLGITTVLTMTTIITGVNASMPRVSYVKAVDIYLWVSFVFVFLSVLEYAAVNYLTT    281 - 350
VQERKERKLREKFPCMCGMLHSKTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLGLSGEANAA    351 - 420
RKKGLLKGQTGFRIFQNTHAIDKYSRLIFPASYIFFNLIYWSVFS                             421 - 465
//

Text Mined References (33)

PMID Year Title