Property Summary

Ligand Count 80
NCBI Gene PubMed Count 102
PubMed Score 135.99
PubTator Score 138.85

Knowledge Summary

Patent (2,715)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Schizoaffective Disorder 55 0.0 5.0

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease -1.231 9.0e-03
adult high grade glioma -2.600 2.2e-04
astrocytic glioma -2.400 1.0e-02
Astrocytoma, Pilocytic -1.600 2.8e-04
atypical teratoid / rhabdoid tumor -1.400 6.5e-10
ependymoma -2.900 3.0e-02
gastric carcinoma -1.600 3.3e-02
glioblastoma -1.800 1.3e-05
group 4 medulloblastoma 1.100 4.1e-02
interstitial cystitis -1.200 1.3e-02
intraductal papillary-mucinous adenoma (... -1.400 5.2e-03
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-02
lung carcinoma 4.400 6.6e-56
medulloblastoma, large-cell -1.100 3.0e-03
non primary Sjogren syndrome sicca -1.100 3.5e-02
oligodendroglioma -1.600 5.0e-07
Pick disease -1.700 1.1e-02
pituitary cancer 1.100 5.2e-07
primitive neuroectodermal tumor -1.100 2.6e-03
psoriasis -1.200 1.1e-15

 CSPA Cell Line (1)

Gene RIF (80)

AA Sequence

MWGLAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIA      1 - 70
SIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRM     71 - 140
IRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQ    141 - 210
FSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGI    211 - 280
TTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAK    281 - 350
NDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS    351 - 420
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN                     421 - 473
//

Text Mined References (108)

PMID Year Title