Property Summary

NCBI Gene PubMed Count 29
Grant Count 294
R01 Count 203
Funding $41,729,879.06
PubMed Score 137.46
PubTator Score 73.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
psoriasis -1.200 0.001
osteosarcoma 2.105 0.000
ependymoma 1.500 0.000
group 4 medulloblastoma 1.700 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
intraductal papillary-mucinous carcinoma... -2.200 0.018
intraductal papillary-mucinous neoplasm ... -1.300 0.011
colon cancer -2.400 0.009
active ulcerative colitis 1.670 0.006
Breast cancer 3.000 0.047
interstitial cystitis -1.200 0.003
lung adenocarcinoma 1.467 0.001
lung carcinoma 1.100 0.000
acute myeloid leukemia -1.600 0.029
ovarian cancer -1.600 0.001
dermatomyositis 1.100 0.004

Synonym

Accession P28370 Q5JV41 Q5JV42
Symbols SWI
ISWI
SWI2
SNF2L
SNF2L1
SNF2LB
SNF2LT
hSNF2L
NURF140

Gene

Gene RIF (10)

PMID Text
25462860 Depletion of a chromatin remodeler, SMARCA1, in cancer cell lines promoted their growth.
23549828 The results suggest that the cAMP-response element consensus sequence in the SNF2L proximal promoter most likely confers constitutive activation and regulation by cAMP in neural cells.
22508985 The effect of SNF2L depletion on gene expression portray the cell in a state of activated Wnt signaling with increased proliferation and locomotion. High levels of SNF2L expression in normal melanocytes contrast with undetectable expression in melanoma.
22233809 expression profiling analyses revealed that SWI/SNF likely antagonizes Polycomb repressive complex 2, implicating this as one possible mechanism of tumor suppression
21738833 ISWI proteins Snf2H, Snf2L as well as Acf1 accumulate at UV-induced DNA damage sites within tens of seconds and reach a plateau after a few minutes.
19996304 Cancers are sensitive to SNF2L knockdown because, unlike their normal counterparts, they lack sufficient compensation from other family members.
18302774 SNF2L mutations are not a cause of X-linked mental retardation in our cohort of patients, although we cannot exclude the possibility that regulatory mutations might exist
18243132 This study provides the first insight into the mechanisms that control basal expression of human SNF2L gene.
15347669 Brahma and Brahma/SWI2-related gene 1 have roles in hypoxic induction of the erythropoietin gene
15310751 a neuronal SNF2L variant inactivates chromatin remodeling

AA Sequence

MEQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATEKGEKKKEKNVSSFQLKLAA      1 - 70
KAPKSEKEMDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLGRPRIKKDEKQSLIS     71 - 140
AGDYRHRRTEQEEDEELLSESRKTSNVCIRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEM    141 - 210
GLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFIRDEMMP    211 - 280
GEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHEL    281 - 350
WALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLS    351 - 420
KMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVSNSGKMVV    421 - 490
LDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREDKFLEVEFLGQREAIEAF    491 - 560
NAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEE    561 - 630
RIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFASKESELTDEDITTILERGEKKT    631 - 700
AEMNERLQKMGESSLRNFRMDIEQSLYKFEGEDYREKQKLGMVEWIEPPKRERKANYAVDAYFREALRVS    701 - 770
EPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPDIPNPALAQREEQKKIDGAEP    771 - 840
LTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQ    841 - 910
DIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFD    911 - 980
RENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEKKKRATKTPMVKF    981 - 1050
SAFS                                                                     1051 - 1054
//

Text Mined References (35)

PMID Year Title
27141965 2016 Setd1a and NURF mediate chromatin dynamics and gene regulation during erythroid lineage commitment and differentiation.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25462860 2015 Frequent involvement of chromatin remodeler alterations in gastric field cancerization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23549828 2013 Human SNF2L gene is regulated constitutively and inducibly in neural cells via a cAMP-response element.
22952240 2012 SWI/SNF chromatin-remodeling factors: multiscale analyses and diverse functions.
22705370 2012 The HARP-like domain-containing protein AH2/ZRANB3 binds to PCNA and participates in cellular response to replication stress.
22577152 2012 Singular v dual inhibition of SNF2L and its isoform, SNF2LT, have similar effects on DNA damage but opposite effects on the DNA damage response, cancer cell growth arrest and apoptosis.
22508985 2012 Nucleosome remodeler SNF2L suppresses cell proliferation and migration and attenuates Wnt signaling.
22233809 2012 Convergent structural alterations define SWItch/Sucrose NonFermentable (SWI/SNF) chromatin remodeler as a central tumor suppressive complex in pancreatic cancer.
More...