Property Summary

NCBI Gene PubMed Count 30
PubMed Score 145.55
PubTator Score 73.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis 1.670 5.5e-03
acute myeloid leukemia -1.600 2.9e-02
atypical teratoid / rhabdoid tumor 1.600 5.3e-07
Breast cancer 3.000 4.7e-02
colon cancer -2.400 9.4e-03
dermatomyositis 1.100 4.4e-03
ependymoma 1.500 6.0e-10
group 4 medulloblastoma 1.700 9.8e-08
interstitial cystitis -1.200 2.8e-03
intraductal papillary-mucinous carcinoma... -2.200 1.8e-02
intraductal papillary-mucinous neoplasm ... -1.300 1.1e-02
lung adenocarcinoma 1.467 6.0e-04
lung carcinoma 1.100 2.8e-21
malignant mesothelioma -2.100 3.7e-07
osteosarcoma 1.887 6.2e-04
ovarian cancer -1.400 3.8e-03
psoriasis -1.100 4.3e-06

Gene RIF (11)

AA Sequence

MEQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATEKGEKKKEKNVSSFQLKLAA      1 - 70
KAPKSEKEMDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLGRPRIKKDEKQSLIS     71 - 140
AGDYRHRRTEQEEDEELLSESRKTSNVCIRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEM    141 - 210
GLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFIRDEMMP    211 - 280
GEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHEL    281 - 350
WALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLS    351 - 420
KMQREWYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVSNSGKMVV    421 - 490
LDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREDKFLEVEFLGQREAIEAF    491 - 560
NAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEE    561 - 630
RIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFASKESELTDEDITTILERGEKKT    631 - 700
AEMNERLQKMGESSLRNFRMDIEQSLYKFEGEDYREKQKLGMVEWIEPPKRERKANYAVDAYFREALRVS    701 - 770
EPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPDIPNPALAQREEQKKIDGAEP    771 - 840
LTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQ    841 - 910
DIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFD    911 - 980
RENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEKKKRATKTPMVKF    981 - 1050
SAFS                                                                     1051 - 1054
//

Text Mined References (38)

PMID Year Title