Property Summary

NCBI Gene PubMed Count 124
PubMed Score 390.08
PubTator Score 234.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.061 1.5e-02
ductal carcinoma in situ -1.500 6.3e-03
ependymoma 4.300 1.6e-02
fibroadenoma -1.100 2.8e-02
glioblastoma multiforme 1.100 1.2e-15
group 4 medulloblastoma -1.400 8.0e-03
intraductal papillary-mucinous adenoma (... -1.300 9.2e-04
intraductal papillary-mucinous carcinoma... -1.100 5.7e-03
invasive ductal carcinoma -1.309 3.2e-02
lung cancer 3.400 2.7e-06
malignant mesothelioma 3.300 6.2e-08
osteosarcoma 2.542 4.4e-04
ovarian cancer 1.100 1.5e-02
psoriasis -1.100 3.3e-05

 GO Component (2)

Gene RIF (112)

AA Sequence

MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADH      1 - 70
RKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKP     71 - 140
ERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLS    141 - 210
LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQR    211 - 280
AALPVAPVGLYTAHVGYSMYHLT                                                   281 - 303
//

Text Mined References (127)

PMID Year Title