Property Summary

NCBI Gene PubMed Count 113
Grant Count 261
R01 Count 147
Funding $20,644,927.47
PubMed Score 374.12
PubTator Score 234.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession P28360 A0SZU5 A8K3M1 Q96NY4
Symbols HOX7
HYD1
ECTD3
STHAG1

Gene

Gene RIF (101)

PMID Text
26556783 The SNPs rs3821949 and rs12532 in the MSX1 gene were associated with congenital heart diseases in Chinese Han populations.
26505791 TBP attenuates Msx1-mediated glycoprotein hormone alpha transcriptional repression.
26030286 a Japanese family with nonsyndromic tooth agenesis caused by a novel nucleotide substitution in the intronic region between exons 1 and 2 of the MSX1 gene, is reported.
25953455 Results were suggestive of a positive association between MSX1 rs11726039 and non-syndromic cleft lip with or without cleft palate in the South Indian population.
25738424 Methylation changes were enriched in MSX1, CCND2, and DAXX at specific loci within the hippocampus of patients with schizophrenia and bipolar disorder.
25501212 A comprehensive meta-analysis of 4 case-control studies was conducted to explore the association between polymorphisms of Msh homeobox 1 (MSX1) and transforming growth factor-beta1 (TGF-beta1) genes and hypodontia.
25484111 The sequence dependence of local conformation of DNA enables MSX1 glutamine50>lysine to make hydrogen bond with its target nucleotide(s) of DNA.
25101640 MSX1 homeodomain mutations are associated with tooth agenesis.
24914010 a non-stop mutation in MSX1 is responsible for oligodontia
24748298 From a genetically diverse etiology MSX 1 799 G >T gene variant may be a good screening marker for NSCL/P in Raichur patients
More...

AA Sequence

MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADH      1 - 70
RKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKP     71 - 140
ERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLS    141 - 210
LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQR    211 - 280
AALPVAPVGLYTAHVGYSMYHLT                                                   281 - 303
//

Text Mined References (116)

PMID Year Title
26556783 2015 Characterization of Transcriptional Repressor Gene MSX1 Variations for Possible Associations with Congenital Heart Diseases.
26505791 2015 Msx1 homeodomain transcription factor and TATA-binding protein interact to repress the expression of the glycoprotein hormone ? subunit gene.
26030286 2015 An aberrant splice acceptor site due to a novel intronic nucleotide substitution in MSX1 gene is the cause of congenital tooth agenesis in a Japanese family.
25953455 2015 Evidence of the involvement of the polymorphisms near MSX1 gene in non-syndromic cleft lip with or without cleft palate.
25738424 2015 Circuit- and Diagnosis-Specific DNA Methylation Changes at ?-Aminobutyric Acid-Related Genes in Postmortem Human Hippocampus in Schizophrenia and Bipolar Disorder.
25501212 2014 Association of MSX1 and TGF-?1 genetic polymorphisms with hypodontia: meta-analysis.
25484111 2015 Role of DNA conformation & energetic insights in Msx-1-DNA recognition as revealed by molecular dynamics studies on specific and nonspecific complexes.
25101640 2014 Characterization of novel MSX1 mutations identified in Japanese patients with nonsyndromic tooth agenesis.
24914010 2014 A novel non-stop mutation in MSX1 causing autosomal dominant non-syndromic oligodontia.
24748298 MSX ? gene variant and non-syndromic clefting: association or rejection?
More...