Property Summary

NCBI Gene PubMed Count 31
Grant Count 10
R01 Count 5
Funding $1,200,394.66
PubMed Score 36.21
PubTator Score 33.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.500 0.000
lung cancer 4.200 0.000
Breast cancer -2.500 0.027
facioscapulohumeral dystrophy 1.700 0.040

Gene RIF (13)

PMID Text
26514226 HOXD9 promotes epithelial-mesenchymal transition and cancer metastasis by ZEB1 regulation in hepatocellular carcinoma
26075790 Data show that overexpressing homeobox D9 protein HOXD9 in mucinous ovarian carcinomas (MOCs)cells augmented the neoplastic phenotype
25826494 HoxD9 expression is regulated by histone acetylation in endothelial progenitor cells
25489884 The study investigates the temperature dependence of the internal motions of the lysine side-chain NH3(+) groups that form ion pairs with DNA phosphate groups in the HoxD9 homeodomain-DNA complex.
24014427 Results show that melanoma patients with HOXD9 hypermethylation in lymph node metastasis had poorer disease-free and overall survival.
23984819 A genome-wide array-comparative genomic hybridization (aCGH) analysis revealed global chromosomal aberration in MWCNTs-treated clones, predominantly at chromosome 2q31-32, where the potential oncogenes HOXD9 and HOXD13 are located
22520331 The association between SNP of the HOXD9 gene and developmental hip dysplasia reached significance in Chinese Han females.
21600039 Our results suggest that HOXD9 may be a novel marker of GCSCs and cell proliferation and/or survival factor in gliomas and glioma cancer stem-like cells, and a potential therapeutic target.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLGGSAGRLKMSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGAQGRPAGVADGPAATAAEFASCSFAP      1 - 70
RSAVFSASWSAVPSQPPAAAAMSGLYHPYVPPPPLAASASEPGRYVRSWMEPLPGFPGGAGGGGGGGGGG     71 - 140
PGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCN    141 - 210
SFLQEKAAAATGGTGPGAGIGAATGTGGSSEPSACSDHPIPGCSLKEEEKQHSQPQQQQLDPNNPAANWI    211 - 280
HARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPK    281 - 350
GD                                                                        351 - 352
//

Text Mined References (35)

PMID Year Title
26514226 2015 HOXD9 promotes epithelial-mesenchymal transition and cancer metastasis by ZEB1 regulation in hepatocellular carcinoma.
26075790 2015 Genome-wide significant risk associations for mucinous ovarian carcinoma.
25826494 2015 Histone acetylation regulates the expression of HoxD9 transcription factor in endothelial progenitor cells.
25489884 2015 Temperature dependence of internal motions of protein side-chain NH3(+) groups: insight into energy barriers for transient breakage of hydrogen bonds.
24014427 2014 Epigenome-wide DNA methylation landscape of melanoma progression to brain metastasis reveals aberrations on homeobox D cluster associated with prognosis.
23984819 2013 Focal amplification of HOXD-harboring chromosome region is implicated in multiple-walled carbon nanotubes-induced carcinogenicity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22520331 2012 Association analysis between HOXD9 genes and the development of developmental dysplasia of the hip in Chinese female Han population.
21600039 2011 Functional analysis of HOXD9 in human gliomas and glioma cancer stem cells.
20700443 2010 Genome-wide association studies of serum magnesium, potassium, and sodium concentrations identify six Loci influencing serum magnesium levels.
More...