Property Summary

NCBI Gene PubMed Count 31
PubMed Score 36.20
PubTator Score 33.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -2.500 2.7e-02
facioscapulohumeral dystrophy 1.700 4.0e-02
lung cancer 1.700 2.0e-03
psoriasis -2.500 3.5e-05

 GO Component (2)

Gene RIF (13)

AA Sequence

MLGGSAGRLKMSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGAQGRPAGVADGPAATAAEFASCSFAP      1 - 70
RSAVFSASWSAVPSQPPAAAAMSGLYHPYVPPPPLAASASEPGRYVRSWMEPLPGFPGGAGGGGGGGGGG     71 - 140
PGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCN    141 - 210
SFLQEKAAAATGGTGPGAGIGAATGTGGSSEPSACSDHPIPGCSLKEEEKQHSQPQQQQLDPNNPAANWI    211 - 280
HARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPK    281 - 350
GD                                                                        351 - 352
//

Text Mined References (35)

PMID Year Title