Property Summary

NCBI Gene PubMed Count 55
PubMed Score 37.71
PubTator Score 137.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Sveinsson chorioretinal atrophy 1
Disease Target Count P-value
astrocytoma 1493 8.33869420607165E-24
oligodendroglioma 2849 3.55110775447492E-18
pediatric high grade glioma 2712 1.99667926794059E-7
sonic hedgehog group medulloblastoma 1482 1.76419225233297E-6
ovarian cancer 8492 1.28357585522077E-5
osteosarcoma 7933 1.80391848599312E-5
Pick disease 1893 3.26031351347205E-5
atypical teratoid / rhabdoid tumor 4369 8.6393253889094E-5
ductal carcinoma in situ 1745 4.42153242655749E-4
invasive ductal carcinoma 2950 5.62151611235457E-4
breast carcinoma 1614 6.83469519976012E-4
primitive neuroectodermal tumor 3031 0.00424685387430693
primary pancreatic ductal adenocarcinoma 1271 0.00439799634131314
chronic rhinosinusitis 512 0.00539557439229109
pancreatic cancer 2300 0.00673934766916386
hereditary spastic paraplegia 313 0.00802031490088691
glioblastoma 5572 0.00962708830178971
subependymal giant cell astrocytoma 2287 0.0142853691655955
spina bifida 1064 0.027932085873544
medulloblastoma, large-cell 6234 0.0300988731764956
ependymoma 2514 0.0418761667960704
Disease Target Count Z-score Confidence
Aicardi syndrome 15 3.573 1.8

Expression

  Differential Expression (21)

Synonym

Accession P28347 A4FUP2 E7EV65
Symbols AA
REF1
TCF13
TEF-1
NTEF-1
TCF-13
TEAD-1

Gene

PANTHER Protein Class (1)

PDB

2HZD   3KYS   4RE1   4Z8E  

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (25)

PMID Text
26295846 TEAD1 mediates YAP1 chromatin-binding genome-wide.
26173433 show that the proangiogenic microfibrillar-associated protein 5 (MFAP5) is a direct transcriptional target of YAP/TEAD in cholangiocarcinoma cells transcription factors.
26091538 Our data suggest that AIC is a genetically heterogeneous disease and is not restricted to the X chromosome, and that TEAD1 mutations may be present in male patients.
25995450 TAZ negatively regulate transcription of DeltaNp63 through TEAD1,2,3 and 4 transcription factors.
25915126 Suggest central role for TEAD and YAP as signal-responsive regulators of multipotent pancreatic progenitors.
25865119 Melanoma reprogramming involves thousands of genomic regulatory regions underlying the proliferative and invasive states, identifying SOX10/MITF and AP-1/TEAD as regulators, respectively.
25628125 Our findings suggest that genetic variants of Hippo pathway genes, particularly YAP1 rs11225163, TEAD1 rs7944031 and TEAD4 rs1990330, may independently or jointly modulate survival of CM patients.
25384421 the YAP-TEAD interaction can be disrupted using cyclic YAP-like peptides, which targets the HIPPO pathway
24953189 TEAD1 causes the nuclear sequestration of p65 leading to a novel TEAD1/p65 complex that associates with the intronic enhancer and is necessary for cytokine induction of MnSOD.
24344135 the first evidence demonstrating that TEAD1 is a novel general repressor of smooth muscle-specific gene expression through interfering with myocardin binding to SRF.
More...

AA Sequence

MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRN      1 - 70
ELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKL     71 - 140
GLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRS    141 - 210
IGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKG    211 - 280
PQNAFFLVKFWADLNCNIQDDAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFV    281 - 350
YRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHI    351 - 420
YRLVKD                                                                    421 - 426
//

Text Mined References (63)

PMID Year Title
26295846 2015 YAP1 Exerts Its Transcriptional Control via TEAD-Mediated Activation of Enhancers.
26173433 2015 YAP promotes proliferation, chemoresistance, and angiogenesis in human cholangiocarcinoma through TEAD transcription factors.
26091538 2015 A De Novo Mutation in TEAD1 Causes Non-X-Linked Aicardi Syndrome.
26045994 2015 miR-222/VGLL4/YAP-TEAD1 regulatory loop promotes proliferation and invasion of gastric cancer cells.
25995450 2015 Hippo Component TAZ Functions as a Co-repressor and Negatively Regulates ?Np63 Transcription through TEA Domain (TEAD) Transcription Factor.
25915126 2015 TEAD and YAP regulate the enhancer network of human embryonic pancreatic progenitors.
25865119 2015 Decoding the regulatory landscape of melanoma reveals TEADS as regulators of the invasive cell state.
25628125 2015 Genetic variants in Hippo pathway genes YAP1, TEAD1 and TEAD4 are associated with melanoma-specific survival.
25384421 2015 Targeting Hippo pathway by specific interruption of YAP-TEAD interaction using cyclic YAP-like peptides.
24953189 2014 A TEAD1/p65 complex regulates the eutherian-conserved MnSOD intronic enhancer, eRNA transcription and the innate immune response.
More...