Property Summary

NCBI Gene PubMed Count 69
PubMed Score 45.22
PubTator Score 137.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.300 1.7e-02
astrocytoma 1.300 8.3e-24
atypical teratoid / rhabdoid tumor 2.200 8.6e-05
breast carcinoma -1.100 6.8e-04
chronic rhinosinusitis -1.053 5.4e-03
ductal carcinoma in situ -1.500 4.4e-04
ependymoma 1.600 4.2e-02
glioblastoma 1.100 1.8e-06
group 3 medulloblastoma 1.200 6.6e-04
hereditary spastic paraplegia -1.253 8.0e-03
invasive ductal carcinoma -2.000 5.6e-04
medulloblastoma, large-cell 1.100 3.0e-02
oligodendroglioma 1.500 3.6e-18
osteosarcoma 1.526 2.1e-05
ovarian cancer -1.700 3.4e-08
pancreatic cancer 1.600 6.7e-03
Pick disease 1.100 3.3e-05
primary pancreatic ductal adenocarcinoma 2.011 4.4e-03
primitive neuroectodermal tumor 1.100 4.2e-03
spina bifida -2.988 2.8e-02
subependymal giant cell astrocytoma 1.519 1.4e-02

Protein-protein Interaction (3)

Gene RIF (34)

AA Sequence

MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRN      1 - 70
ELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKL     71 - 140
GLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRS    141 - 210
IGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKG    211 - 280
PQNAFFLVKFWADLNCNIQDDAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFV    281 - 350
YRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHI    351 - 420
YRLVKD                                                                    421 - 426
//

Text Mined References (76)

PMID Year Title