Property Summary

NCBI Gene PubMed Count 56
Grant Count 18
R01 Count 7
Funding $1,647,046.81
PubMed Score 41.62
PubTator Score 76.20

Knowledge Summary

Patent (4,261)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Mammary Neoplasms 410
psoriasis 6,683

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.003

Gene RIF (3)

PMID Text
24349381 Hypoxia regulates the expression of the neuromedin B receptor through a mechanism dependent on hypoxia-inducible factor-1alpha.
21060863 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15528253 NMB and its receptor are coexpressed by proliferating cells in which they act in an autocrine fashion with similar and modest potency in both normal and malignant colonic epithelial cells.

AA Sequence

MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFIT      1 - 70
NSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSAD     71 - 140
RYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYPQTDELHPK    141 - 210
IHSVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWF    211 - 280
PNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERG    281 - 350
TSYLLSSSAVRMTSLKSNAKNMVTNSVLLNGHSMKQEMAL                                  351 - 390
//

Publication (44)

PMID Year Title
27092952 2016 PDE7B, NMBR and EPM2A Variants and Schizophrenia: A Case-Control and Pharmacogenetics Study.
26590027 2016 Viability of D283 medulloblastoma cells treated with a histone deacetylase inhibitor combined with bombesin receptor antagonists.
26030739 2015 Monitoring ?-arrestin recruitment via ?-lactamase enzyme fragment complementation: purification of peptide E as a low-affinity ligand for mammalian bombesin receptors.
25517020 2015 Bombesin-like peptides and their receptors: recent findings in pharmacology and physiology.
24349381 2013 Hypoxia regulates the expression of the neuromedin B receptor through a mechanism dependent on hypoxia-inducible factor-1?.
24092425 2013 Anti-EGFR therapy combined with neuromedin B receptor blockade induces the death of DAOY medulloblastoma cells.
22249826 2012 Appetite-modifying effects of bombesin receptor subtype-3 agonists.
21908103 2011 Neuromedin B receptor antagonist suppresses tumor angiogenesis and tumor growth in vitro and in vivo.
21729729 2011 Pharmacology and selectivity of various natural and synthetic bombesin related peptide agonists for human and rat bombesin receptors differs.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
More...