Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
R01 Count 6
Funding $352,324.75
PubMed Score 29.62
PubTator Score 19.59

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
26364852 These results support an unanticipated role of cystatin D in the cell nucleus, controlling the transcription of specific genes involved in crucial cellular functions, which may mediate its protective action in colon cancer.
26158294 Results imply CST5 as an important mediator of tumor suppression by p53 in colorectal cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20223287 activation of the RhoA-ROCK-p38MAPK-MSK signaling pathway is essential for the regulation of the phenotype and of the CST5/cystatin D candidate tumor suppressor and other target genes by 1,25(OH)2D3 in colon cancer cells
19662683 Cystatin D is a candidate tumor suppressor gene induced by vitamin D in human colon cancer cells.
15728581 Compared with its homologues, cystatin D presents an unusual inhibition profile with a preferential inhibition cathepsin S > cathepsin H > cathepsin L and no inhibition of cathepsin B or pig legumain.

AA Sequence

MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQ      1 - 70
VMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCR     71 - 140
KV                                                                        141 - 142
//

Publication (25)

PMID Year Title
26364852 2015 Cystatin D locates in the nucleus at sites of active transcription and modulates gene and protein expression.
26158294 2015 p53 directly activates cystatin D/CST5 to mediate mesenchymal-epithelial transition: a possible link to tumor suppression by vitamin D3.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20223287 2010 The effects of 1,25-dihydroxyvitamin D3 on colon cancer cells depend on RhoA-ROCK-p38MAPK-MSK signaling.
20189825 2010 Confident assignment of intact mass tags to human salivary cystatins using top-down Fourier-transform ion cyclotron resonance mass spectrometry.
19662683 2009 Cystatin D is a candidate tumor suppressor gene induced by vitamin D in human colon cancer cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...