Property Summary

NCBI Gene PubMed Count 24
PubMed Score 11.44
PubTator Score 17.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Alzheimer's disease 1.200 3.7e-02
intraductal papillary-mucinous neoplasm ... 1.200 7.5e-03
juvenile dermatomyositis 1.062 8.9e-10
lung cancer 1.100 2.4e-02
malignant mesothelioma 1.700 2.2e-05
medulloblastoma, large-cell 1.200 2.7e-05
non primary Sjogren syndrome sicca -1.100 1.8e-02
osteosarcoma 2.280 3.3e-07
ovarian cancer -1.500 9.8e-06
pancreatic cancer 1.100 8.1e-03
Pick disease 1.600 8.5e-07
primary pancreatic ductal adenocarcinoma 1.130 9.8e-03
progressive supranuclear palsy -1.100 4.8e-03
tuberculosis and treatment for 6 months 1.400 1.1e-03
ulcerative colitis 1.300 9.5e-06

Gene RIF (7)

AA Sequence

MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKN      1 - 70
IIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRND     71 - 140
YIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISI    141 - 210
GPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDT    211 - 280
DIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT    281 - 350
ASLTPAFFSQTPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPST    351 - 420
PGPFSPDLQKT                                                               421 - 431
//

Text Mined References (28)

PMID Year Title