Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
R01 Count 2
Funding $184,241.14
PubMed Score 9.77
PubTator Score 17.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P28324 P28323 Q6GSJ2
Symbols SAP1

Gene

PANTHER Protein Class (1)

PDB

1BC7   1BC8   1HBX   1K6O  

Gene RIF (6)

PMID Text
26938874 CTCF has a role in regulating SLC45A3-ELK4 Chimeric RNA
26028036 ELK4 is overexpressed in melanoma and knocking down the ELK4 or CDK2 expression significantly attenuated the malignant phenotype of melanoma cells
22719019 Data suggest that chimeric SLC45A3-ELK4 controls prostate cancer cell proliferation, and the chimera level correlates with prostate cancer disease progression.
19136943 SLC45A3-ELK4 may represent the first description of a recurrent RNA chimaeric transcript specific to prostate cancer that does not have a detectable DNA aberration
18469865 ELK4 is a direct androgen receptor target in prostate cancer cells. Androgens may thus contribute to the growth of prostate cancer via influencing ELK4 levels
11846562 Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex

AA Sequence

MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKN      1 - 70
IIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRND     71 - 140
YIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISI    141 - 210
GPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDT    211 - 280
DIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT    281 - 350
ASLTPAFFSQTPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPST    351 - 420
PGPFSPDLQKT                                                               421 - 431
//

Publication (25)

PMID Year Title
26938874 2016 Role of CTCF in Regulating SLC45A3-ELK4 Chimeric RNA.
26028036 2016 Cyclin-dependent kinase 2 (CDK2) is a key mediator for EGF-induced cell transformation mediated through the ELK4/c-Fos signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22722849 2012 SIRT7 links H3K18 deacetylation to maintenance of oncogenic transformation.
22719019 2012 Chimeric transcript generated by cis-splicing of adjacent genes regulates prostate cancer cell proliferation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19136943 2009 Transcriptome sequencing to detect gene fusions in cancer.
18469865 2008 Identification of ETS-like transcription factor 4 as a novel androgen receptor target in prostate cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...