Property Summary

NCBI Gene PubMed Count 169
PubMed Score 2227.06
PubTator Score 523.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Keratoconus 113 3.715 1.9
Disease Target Count Z-score Confidence
Aortic aneurysm 38 3.005 1.5
Disease Target Count Z-score Confidence
Cancer 2499 5.072 2.5
Atherosclerosis 291 3.662 1.8
Arthritis 290 3.351 1.7

Expression

  Differential Expression (25)

Disease log2 FC p
osteosarcoma 3.610 2.5e-03
active Crohn's disease 1.916 3.1e-02
adult high grade glioma 2.100 1.6e-02
Astrocytoma, Pilocytic 1.500 1.3e-02
Atopic dermatitis -1.700 2.6e-04
atypical teratoid / rhabdoid tumor 3.100 5.6e-04
Breast cancer 3.500 2.7e-02
Duchenne muscular dystrophy 1.016 2.0e-06
ependymoma 2.700 3.2e-02
glioblastoma 1.800 2.3e-03
group 3 medulloblastoma 2.700 1.8e-04
interstitial cystitis 1.900 1.1e-04
intraductal papillary-mucinous adenoma (... -1.700 4.2e-02
intraductal papillary-mucinous carcinoma... -2.000 2.9e-02
lung carcinoma -2.100 1.4e-19
malignant mesothelioma -4.600 2.6e-09
mucosa-associated lymphoid tissue lympho... -1.131 1.8e-02
non-small cell lung cancer 2.198 3.0e-12
ovarian cancer -1.800 7.9e-03
pancreatic cancer 1.300 1.0e-02
Polycystic ovary syndrome -1.133 5.0e-02
primary pancreatic ductal adenocarcinoma 1.058 4.4e-02
primitive neuroectodermal tumor 2.100 4.0e-02
psoriasis -1.100 5.3e-03
ulcerative colitis 1.100 1.2e-02

Protein-protein Interaction (10)

Gene RIF (140)

AA Sequence

MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRR      1 - 70
DPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGAS     71 - 140
RAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQY    141 - 210
GLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPS    211 - 280
RPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG    281 - 350
CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY       351 - 417
//

Text Mined References (170)

PMID Year Title