Property Summary

NCBI Gene PubMed Count 150
PubMed Score 2062.95
PubTator Score 523.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 1.36081795662315E-19
posterior fossa group A ependymoma 1511 1.5996133545789E-18
non-small cell lung cancer 2798 3.03573161132418E-12
malignant mesothelioma 3163 2.64875714103701E-9
atypical teratoid/rhabdoid tumor 1095 2.71797538788812E-9
Duchenne muscular dystrophy 602 2.04672168781457E-6
pediatric high grade glioma 2712 8.61942263285219E-6
Atopic dermatitis 944 3.81600617136545E-5
glioblastoma 5572 6.06528755215924E-5
group 3 medulloblastoma 2254 1.84923526208405E-4
interstitial cystitis 2299 2.87214514306392E-4
ulcerative colitis 2087 0.00298689372440304
ovarian cancer 8492 0.00389834082991921
psoriasis 6685 0.00531268270552243
pancreatic cancer 2300 0.00603963859274325
pilocytic astrocytoma 3086 0.0109378774669856
mucosa-associated lymphoid tissue lymphoma 480 0.0183838441315261
Breast cancer 3099 0.0265848840380967
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0294420291398402
active Crohn's disease 918 0.0306762397475625
primitive neuroectodermal tumor 3031 0.0402711716417562
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0415913698713987
primary pancreatic ductal adenocarcinoma 1271 0.0438843934890107
Polycystic Ovary Syndrome 335 0.0498733117608991
Disease Target Count Z-score Confidence
Aortic aneurysm 34 0.0 4.0

Expression

Synonym

Accession P28300 B2R5Q3 Q5FWF0
Symbols AAT10

Gene

LOX

PANTHER Protein Class (3)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (123)

PMID Text
26908052 Results show that LOX expression regulation by FoxF1 increases invasiveness of breast cancer cells.
26893379 The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites.
26838787 Individuals with LOX variants had fusiform enlargement of the aortic root and ascending thoracic aorta, leading to ascending aortic dissections.
26713757 two LOX variants, rs2956540 and rs10519694, may affect individual susceptibility to keratoconus
26515140 LOX expression at the mRNA and protein level, and enzymatic activity were remarkably upregulated in the hypoxic A549 cells, compared with normoxic A549 cells.
26437801 Cu chaperone function of Atox1 mediated through Cu transporter ATP7A is required for VEGF-induced angiogenesis via activation of Cu enzyme lysyl oxidase.
26085300 hypoxic stress of obstructive sleep apnea may increase circulating lysyl oxidase (LOX) levels; LOX may serve as a biomarker of liver fibrosis in patients with severe obesity and nonalcoholic fatty liver disease
26077591 Using principal component analysis (PCA), the authors identified a LOX/hypoxia signature associated with poor patient survival in resectable pancreatic ductal adenocarcinoma patients.
26048020 LOX gene expression is a predictive factor in hepatocellular liver cancer prognosis and mortality.
26017313 LOX is a novel regulator of NFATc1-driven osteoclastogenesis, independent of RANK ligand, which disrupts normal bone homeostasis leading to the formation of focal pre-metastatic lesions
More...

AA Sequence

MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRR      1 - 70
DPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGAS     71 - 140
RAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQY    141 - 210
GLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPS    211 - 280
RPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG    281 - 350
CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY       351 - 417
//

Text Mined References (151)

PMID Year Title
26908052 2016 Forkhead Box F1 promotes breast cancer cell migration by upregulating lysyl oxidase and suppressing Smad2/3 signaling.
26893379 2016 Fibromodulin Interacts with Collagen Cross-linking Sites and Activates Lysyl Oxidase.
26838787 2016 LOX Mutations Predispose to Thoracic Aortic Aneurysms and Dissections.
26713757 2015 Association of Common Variants in LOX with Keratoconus: A Meta-Analysis.
26601954 2016 Characterization of Microfibrillar-associated Protein 4 (MFAP4) as a Tropoelastin- and Fibrillin-binding Protein Involved in Elastic Fiber Formation.
26515140 2016 Lysyl oxidase mediates hypoxia-induced radioresistance in non-small cell lung cancer A549 cells.
26437801 2015 Copper Transport Protein Antioxidant-1 Promotes Inflammatory Neovascularization via Chaperone and Transcription Factor Function.
26085300 2015 Lysyl Oxidase as a Serum Biomarker of Liver Fibrosis in Patients with Severe Obesity and Obstructive Sleep Apnea.
26077591 2015 Targeting the LOX/hypoxia axis reverses many of the features that make pancreatic cancer deadly: inhibition of LOX abrogates metastasis and enhances drug efficacy.
26048020 2015 Lysyl Oxidase Is Predictive of Unfavorable Outcomes and Essential for Regulation of Vascular Endothelial Growth Factor in Hepatocellular Carcinoma.
More...