Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.18
PubTator Score 25.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.048
astrocytic glioma -1.300 0.028
ependymoma 1.300 0.024
oligodendroglioma -1.200 0.037
Barrett's esophagus 1.100 0.031
glioblastoma 1.300 0.006
osteosarcoma 1.358 0.018
medulloblastoma, large-cell -1.300 0.016
primary pancreatic ductal adenocarcinoma -1.277 0.004
intraductal papillary-mucinous carcinoma... -1.300 0.003
lung adenocarcinoma -1.200 0.000
pediatric high grade glioma 1.200 0.003
pilocytic astrocytoma 1.200 0.000
non primary Sjogren syndrome sicca -1.100 0.033
lung carcinoma -1.700 0.000
spina bifida -1.928 0.039
ovarian cancer -1.600 0.000
pituitary cancer 1.800 0.000
Down syndrome 1.200 0.001
pancreatic cancer -1.200 0.007

Gene RIF (5)

PMID Text
21873152 the predicted coiled-coil region & the region adjacent to the coiled-coil region of the carboxyl-terminus of KRAP may be crucial for its interaction with the cytoskeleton or directional targeting toward the apical pole in polarized epithelial cells
21501587 the critical region of KRAP protein for the regulation of IP(3)R was determined.
21457704 KRAP is involved in the proper regulation of IP3R-mediated Ca2+ release.
17934691 results suggested that KRAP might be a cytoskeleton-associated protein involving the structural integrity and/or signal transductions in human cancers.
14673706 localized as a membrane-bound form with extracellular regions; results suggested KRAP might be involved in the regulation of filamentous actin and signals from the outside of the cells

AA Sequence

MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQDEEEDEEEDLPGAQLPAAGGR      1 - 70
GNVPNEKIAIWLKDCRTPLGASLDEQSSSTLKGVLVRNGGSFEDDLSLGAEANHLHESDAQIENCNNILA     71 - 140
KERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDPEEILYNLGFGRDEPDIASKIPSRFFNSSSF    141 - 210
AKGIDIKVFLSAQMQRMEVENPNYALTSRFRQIEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSNKET    211 - 280
DPPPPLTRSNTANRLMKTLSKLNLCVDKTEKGESSSPSPSAEKGKILNVSVIEESGNKNDQKSQKIMKKK    281 - 350
ESSSMLATVKEEVSGSSAAVTENADSDRISDEANSNFNQGTENEQSKETQSHESKLGEESGIVESKLDSD    351 - 420
FNISSHSELENSSELKSVHISTPEKEPCAPLTIPSIRNIMTQQKDSFEMEEVQSTEGEAPHVPATYQLGL    421 - 490
TKSKRDHLLRTASQHSDSSGFAEDSTDCLSLNHLQVQESLQAMGSSADSCDSETTVTSLGEDLATPTAQD    491 - 560
QPYFNESEEESLVPLQKGLEKAAAVADKRKSGSQDFPQCNTIENTGTKQSTCSPGDHIIEITEVEEDLFP    561 - 630
AETVELLREASAESDVGKSSESEFTQYTTHHILKSLASIEAKCSDMSSENTTGPPSSMDRVNTALQRAQM    631 - 700
KVCSLSNQRMGRSLLKSKDLLKQRYLFAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPS    701 - 770
FTYKYTPEEEQELEKRVMEHDGQSLVKSTIFISPSSVKKEEAPQSEAPRVEECHHGRTPTCSRLAPPPMS    771 - 840
QSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNPPSAIE    841 - 910
MQLRRVLHDIRNSLQNLSQYPMMRGPDPAAAPYSTQKSSVLPLYENTFQELQVMRRSLNLFRTQMMDLEL    911 - 980
AMLRQQTMVYHHMTEEERFEVDQLQGLRNSVRMELQDLELQLEERLLGLEEQLRAVRMPSPFRSSALMGM    981 - 1050
CGSRSADNLSCPSPLNVMEPVTELMQEQSYLKSELGLGLGEMGFEIPPGESSESVFSQATSESSSVCSGP   1051 - 1120
SHANRRTGVPSTASVGKSKTPLVARKKVFRASVALTPTAPSRTGSVQTPPDLESSEEVDAAEGAPEVVGP   1121 - 1190
KSEVEEGHGKLPSMPAAEEMHKNVEQDELQQVIREIKESIVGEIRREIVSGLLAAVSSSKASNSKQDYH    1191 - 1259
//

Text Mined References (25)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23541577 2013 Tespa1 protein is phosphorylated in response to store-operated calcium entry.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21873152 2011 KRAS-induced actin-interacting protein: a potent target for obesity, diabetes and cancer.
21501587 2011 Determination of the critical region of KRAS-induced actin-interacting protein for the interaction with inositol 1,4,5-trisphosphate receptor.
21457704 2011 KRAS-induced actin-interacting protein regulates inositol 1,4,5-trisphosphate-receptor-mediated calcium release.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17934691 2007 Analysis of KRAP expression and localization, and genes regulated by KRAP in a human colon cancer cell line.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673706 2004 Deregulated expression of KRAP, a novel gene encoding actin-interacting protein, in human colon cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.
9740325 1998 Cloning and sequencing of cDNA encoding for a human sperm antigen involved in fertilization.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1555770 1992 Human cleavage signal-1 protein; cDNA cloning, transcription and immunological analysis.