Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.36
PubTator Score 25.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.300 2.8e-02
Astrocytoma, Pilocytic 1.200 1.0e-04
Barrett's esophagus 1.100 3.1e-02
Down syndrome 1.200 7.1e-04
ependymoma 1.300 2.4e-02
glioblastoma 1.300 5.5e-03
intraductal papillary-mucinous carcinoma... -1.300 3.2e-03
lung adenocarcinoma -1.100 1.4e-16
lung carcinoma -1.700 9.1e-30
medulloblastoma, large-cell -1.300 1.6e-02
non primary Sjogren syndrome sicca -1.100 3.3e-02
oligodendroglioma -1.200 3.7e-02
osteosarcoma 1.358 1.8e-02
ovarian cancer -1.600 9.0e-05
pancreatic cancer -1.200 6.5e-03
pediatric high grade glioma 1.200 2.7e-03
pituitary cancer 1.200 7.5e-06
primary pancreatic ductal adenocarcinoma -1.277 4.3e-03
Rheumatoid arthritis 1.300 4.8e-02
spina bifida -1.928 3.9e-02

Gene RIF (6)

AA Sequence

MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQDEEEDEEEDLPGAQLPAAGGR      1 - 70
GNVPNEKIAIWLKDCRTPLGASLDEQSSSTLKGVLVRNGGSFEDDLSLGAEANHLHESDAQIENCNNILA     71 - 140
KERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDPEEILYNLGFGRDEPDIASKIPSRFFNSSSF    141 - 210
AKGIDIKVFLSAQMQRMEVENPNYALTSRFRQIEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSNKET    211 - 280
DPPPPLTRSNTANRLMKTLSKLNLCVDKTEKGESSSPSPSAEKGKILNVSVIEESGNKNDQKSQKIMKKK    281 - 350
ESSSMLATVKEEVSGSSAAVTENADSDRISDEANSNFNQGTENEQSKETQSHESKLGEESGIVESKLDSD    351 - 420
FNISSHSELENSSELKSVHISTPEKEPCAPLTIPSIRNIMTQQKDSFEMEEVQSTEGEAPHVPATYQLGL    421 - 490
TKSKRDHLLRTASQHSDSSGFAEDSTDCLSLNHLQVQESLQAMGSSADSCDSETTVTSLGEDLATPTAQD    491 - 560
QPYFNESEEESLVPLQKGLEKAAAVADKRKSGSQDFPQCNTIENTGTKQSTCSPGDHIIEITEVEEDLFP    561 - 630
AETVELLREASAESDVGKSSESEFTQYTTHHILKSLASIEAKCSDMSSENTTGPPSSMDRVNTALQRAQM    631 - 700
KVCSLSNQRMGRSLLKSKDLLKQRYLFAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPS    701 - 770
FTYKYTPEEEQELEKRVMEHDGQSLVKSTIFISPSSVKKEEAPQSEAPRVEECHHGRTPTCSRLAPPPMS    771 - 840
QSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNPPSAIE    841 - 910
MQLRRVLHDIRNSLQNLSQYPMMRGPDPAAAPYSTQKSSVLPLYENTFQELQVMRRSLNLFRTQMMDLEL    911 - 980
AMLRQQTMVYHHMTEEERFEVDQLQGLRNSVRMELQDLELQLEERLLGLEEQLRAVRMPSPFRSSALMGM    981 - 1050
CGSRSADNLSCPSPLNVMEPVTELMQEQSYLKSELGLGLGEMGFEIPPGESSESVFSQATSESSSVCSGP   1051 - 1120
SHANRRTGVPSTASVGKSKTPLVARKKVFRASVALTPTAPSRTGSVQTPPDLESSEEVDAAEGAPEVVGP   1121 - 1190
KSEVEEGHGKLPSMPAAEEMHKNVEQDELQQVIREIKESIVGEIRREIVSGLLAAVSSSKASNSKQDYH    1191 - 1259
//

Text Mined References (27)

PMID Year Title