Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.18
PubTator Score 25.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.048
astrocytic glioma -1.300 0.028
ependymoma 1.300 0.024
oligodendroglioma -1.200 0.037
Barrett's esophagus 1.100 0.031
glioblastoma 1.300 0.006
osteosarcoma 1.358 0.018
medulloblastoma, large-cell -1.300 0.016
primary pancreatic ductal adenocarcinoma -1.277 0.004
intraductal papillary-mucinous carcinoma... -1.300 0.003
lung adenocarcinoma -1.200 0.000
pediatric high grade glioma 1.200 0.003
pilocytic astrocytoma 1.200 0.000
non primary Sjogren syndrome sicca -1.100 0.033
lung carcinoma -1.700 0.000
spina bifida -1.928 0.039
ovarian cancer -1.600 0.000
pituitary cancer 1.800 0.000
Down syndrome 1.200 0.001
pancreatic cancer -1.200 0.007

Gene RIF (5)

PMID Text
21873152 the predicted coiled-coil region & the region adjacent to the coiled-coil region of the carboxyl-terminus of KRAP may be crucial for its interaction with the cytoskeleton or directional targeting toward the apical pole in polarized epithelial cells
21501587 the critical region of KRAP protein for the regulation of IP(3)R was determined.
21457704 KRAP is involved in the proper regulation of IP3R-mediated Ca2+ release.
17934691 results suggested that KRAP might be a cytoskeleton-associated protein involving the structural integrity and/or signal transductions in human cancers.
14673706 localized as a membrane-bound form with extracellular regions; results suggested KRAP might be involved in the regulation of filamentous actin and signals from the outside of the cells

AA Sequence

MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQDEEEDEEEDLPGAQLPAAGGR      1 - 70
GNVPNEKIAIWLKDCRTPLGASLDEQSSSTLKGVLVRNGGSFEDDLSLGAEANHLHESDAQIENCNNILA     71 - 140
KERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDPEEILYNLGFGRDEPDIASKIPSRFFNSSSF    141 - 210
AKGIDIKVFLSAQMQRMEVENPNYALTSRFRQIEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSNKET    211 - 280
DPPPPLTRSNTANRLMKTLSKLNLCVDKTEKGESSSPSPSAEKGKILNVSVIEESGNKNDQKSQKIMKKK    281 - 350
ESSSMLATVKEEVSGSSAAVTENADSDRISDEANSNFNQGTENEQSKETQSHESKLGEESGIVESKLDSD    351 - 420
FNISSHSELENSSELKSVHISTPEKEPCAPLTIPSIRNIMTQQKDSFEMEEVQSTEGEAPHVPATYQLGL    421 - 490
TKSKRDHLLRTASQHSDSSGFAEDSTDCLSLNHLQVQESLQAMGSSADSCDSETTVTSLGEDLATPTAQD    491 - 560
QPYFNESEEESLVPLQKGLEKAAAVADKRKSGSQDFPQCNTIENTGTKQSTCSPGDHIIEITEVEEDLFP    561 - 630
AETVELLREASAESDVGKSSESEFTQYTTHHILKSLASIEAKCSDMSSENTTGPPSSMDRVNTALQRAQM    631 - 700
KVCSLSNQRMGRSLLKSKDLLKQRYLFAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPS    701 - 770
FTYKYTPEEEQELEKRVMEHDGQSLVKSTIFISPSSVKKEEAPQSEAPRVEECHHGRTPTCSRLAPPPMS    771 - 840
QSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNPPSAIE    841 - 910
MQLRRVLHDIRNSLQNLSQYPMMRGPDPAAAPYSTQKSSVLPLYENTFQELQVMRRSLNLFRTQMMDLEL    911 - 980
AMLRQQTMVYHHMTEEERFEVDQLQGLRNSVRMELQDLELQLEERLLGLEEQLRAVRMPSPFRSSALMGM    981 - 1050
CGSRSADNLSCPSPLNVMEPVTELMQEQSYLKSELGLGLGEMGFEIPPGESSESVFSQATSESSSVCSGP   1051 - 1120
SHANRRTGVPSTASVGKSKTPLVARKKVFRASVALTPTAPSRTGSVQTPPDLESSEEVDAAEGAPEVVGP   1121 - 1190
KSEVEEGHGKLPSMPAAEEMHKNVEQDELQQVIREIKESIVGEIRREIVSGLLAAVSSSKASNSKQDYH    1191 - 1259
//

Text Mined References (25)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23541577 2013 Tespa1 protein is phosphorylated in response to store-operated calcium entry.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21873152 2011 KRAS-induced actin-interacting protein: a potent target for obesity, diabetes and cancer.
21501587 2011 Determination of the critical region of KRAS-induced actin-interacting protein for the interaction with inositol 1,4,5-trisphosphate receptor.
21457704 2011 KRAS-induced actin-interacting protein regulates inositol 1,4,5-trisphosphate-receptor-mediated calcium release.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...