Property Summary

NCBI Gene PubMed Count 29
PubMed Score 71.12
PubTator Score 35.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Ovarian Cysts 34
Prostatic Neoplasms 471
Disease Target Count P-value
non-small cell lung cancer 2798 4.24027861163924E-36
lung adenocarcinoma 2714 1.20917757765375E-16
atypical teratoid / rhabdoid tumor 4369 5.30502358036632E-14
colon cancer 1475 5.52884034596716E-8
ovarian cancer 8492 1.01226665273202E-6
medulloblastoma, large-cell 6234 2.79504034850318E-6
malignant mesothelioma 3163 6.18117276979516E-6
lung cancer 4473 6.26535332594496E-6
adrenocortical carcinoma 1427 2.8948733786343E-5
osteosarcoma 7933 7.94043860828202E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.4458860116126E-4
pilocytic astrocytoma 3086 1.92828294381368E-4
ductal carcinoma in situ 1745 1.9809008803914E-4
psoriasis 6685 2.82407918147114E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.80709853719604E-4
invasive ductal carcinoma 2950 4.96790357109153E-4
group 3 medulloblastoma 2254 8.1142272647474E-4
pituitary cancer 1972 0.00437679796767604
primitive neuroectodermal tumor 3031 0.00536918606334878
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00980114064386446
adrenocortical adenoma 134 0.0110869039586589
aldosterone-producing adenoma 664 0.0146468648867736
glioblastoma 5572 0.0180133757896448

Expression

Synonym

Accession P28289 B2RB77 Q5T7W3 Q9BUF1
Symbols TMOD
ETMOD
D9S57E

Gene

PDB

4PKG   4PKH   4PKI   4Z8G   4Z94  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG

Gene RIF (8)

PMID Text
26873245 The mutation reduced binding affinity for both Lmod2 and Tmod1. The effect of the K15N mutation on Tpm1.1 binding to Lmod2 and Tmod1 provides a molecular rationale for the development of familial dilated cardiomyopathies .
25398440 Study highlighted a novel TMOD1-mediated link between NF-kappaB activation and MMP13 induction, which accounts in part for the NF-kappaB-dependent malignant phenotype of TNBC.
25061212 The structures and biochemical analysis of structure-inspired mutants showed that one Tmod molecule interacts with three actin subunits at the pointed end, while also contacting two tropomyosin molecules on each side of the filament.
24922351 Tmod1 and Tmod3 showed somewhat different tropomyosin-binding site utilization.
16434395 study identifies several amino acid residues on Tmod-1 that are important for its interaction with TM5 (a nonmuscle TM isoform)
16297372 The N-terminal "KRK ring" may participate in balancing electrostatic force with hydrophobic interaction in dimerization of TM and its binding to E-Tmod.
15095301 levels of TM1, TM2 and TM3 are reduced in human transitional cell carcinoma cells, but significantly upregulated by inhibition of the mitogen-activated protein kinase-signaling pathway
11964245 Tropomyosin requires an intact N-terminal coiled coil to interact with this protein

AA Sequence

MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH      1 - 70
LEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL     71 - 140
MSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI    141 - 210
PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNT    211 - 280
SLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP    281 - 350
IIPKCRSGV                                                                 351 - 359
//

Text Mined References (31)

PMID Year Title
26873245 2016 Localization of the binding interface between leiomodin-2 and ?-tropomyosin.
26370058 2015 How Leiomodin and Tropomodulin use a common fold for different actin assembly functions.
25398440 2015 Tropomodulin 1 expression driven by NF-?B enhances breast cancer growth.
25250574 2014 Leiomodin-3 dysfunction results in thin filament disorganization and nemaline myopathy.
25061212 2014 Mechanism of actin filament pointed-end capping by tropomodulin.
24922351 2014 Functional effects of mutations in the tropomyosin-binding sites of tropomodulin1 and tropomodulin3.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
20350937 2010 The FOXE1 locus is a major genetic determinant for radiation-related thyroid carcinoma in Chernobyl.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
More...