Property Summary

NCBI Gene PubMed Count 31
PubMed Score 74.12
PubTator Score 35.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical adenoma -1.046 1.4e-02
adrenocortical carcinoma -1.906 1.0e-04
aldosterone-producing adenoma -1.348 1.5e-02
Astrocytoma, Pilocytic 1.200 2.1e-04
atypical teratoid / rhabdoid tumor -2.700 5.3e-14
colon cancer -3.800 5.5e-08
ductal carcinoma in situ -1.200 2.0e-04
glioblastoma 1.500 1.8e-02
group 3 medulloblastoma -2.400 8.1e-04
intraductal papillary-mucinous adenoma (... -1.500 6.2e-04
intraductal papillary-mucinous carcinoma... -1.400 8.5e-04
intraductal papillary-mucinous neoplasm ... -1.400 2.8e-02
invasive ductal carcinoma -1.500 5.0e-04
lung adenocarcinoma -1.700 1.2e-16
lung cancer -3.000 6.3e-06
malignant mesothelioma -1.100 6.2e-06
medulloblastoma, large-cell -2.500 1.8e-07
non-small cell lung cancer -1.248 3.1e-23
osteosarcoma -2.739 6.4e-04
ovarian cancer -2.200 2.3e-06
pituitary cancer -1.400 4.4e-03
primitive neuroectodermal tumor -1.900 1.4e-03
psoriasis -1.600 2.8e-04

Protein-protein Interaction (10)

Gene RIF (9)

AA Sequence

MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH      1 - 70
LEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL     71 - 140
MSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI    141 - 210
PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNT    211 - 280
SLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP    281 - 350
IIPKCRSGV                                                                 351 - 359
//

Text Mined References (32)

PMID Year Title