Property Summary

NCBI Gene PubMed Count 46
Grant Count 2
Funding $339,584.5
PubMed Score 63.96
PubTator Score 60.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
gastric cancer 1.100 0.000
Waldenstrons macroglobulinemia 1.182 0.006
astrocytic glioma 1.500 0.015
ependymoma 1.700 0.004
oligodendroglioma 1.100 0.030
osteosarcoma 2.371 0.002
glioblastoma 2.500 0.000
atypical teratoid / rhabdoid tumor 2.300 0.000
medulloblastoma 1.800 0.001
medulloblastoma, large-cell 2.600 0.000
pancreatic ductal adenocarcinoma liver m... -1.621 0.014
intraductal papillary-mucinous adenoma (... 1.200 0.015
Breast cancer 4.100 0.022
interstitial cystitis -1.100 0.002
pediatric high grade glioma 1.800 0.001
aldosterone-producing adenoma -1.272 0.026
psoriasis 2.100 0.000
breast carcinoma 1.100 0.000
Alzheimer's disease -1.200 0.037
Pick disease -1.100 0.002
progressive supranuclear palsy -1.200 0.017
invasive ductal carcinoma 1.700 0.008
ulcerative colitis -1.800 0.000
ovarian cancer -1.200 0.000
dermatomyositis 1.400 0.000

Synonym

Accession P28288 D3DT46 Q15271 Q6NUN5 Q96DA3 Q9H529
Symbols ZWS2
ABC43
CBAS5
PMP70
PXMP1

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (19)

PMID Text
25802834 Increased ABCD3 expression correlates with Gleason Score.
25168382 Deficiency of peroxisomal ABCD3 resulted in bile acid biosynthesis defect.
24333844 We postulate a role for human ABCD3 in the oxidation of dicarboxylic acids and a role in buffering fatty acids that are overflowing from the mitochondrial beta-oxidation system
22190034 HIV-1 Vpr is identified to have a physical interaction with ATP-binding cassette, sub-family D (ALD), member 3 (ABCD3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20661612 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20007743 investigation of organelle-targeting properties of N-terminal portions of peroxisomal PMP70; amino acid sequence and domain structure of human form discussed
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQI      1 - 70
LKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKRYLLNFIAAMPLISLVN     71 - 140
NFLKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQDVEKFCNSVVDLYSNLSKP    141 - 210
FLDIVLYIFKLTSAIGAQGPASMMAYLVVSGLFLTRLRRPIGKMTITEQKYEGEYRYVNSRLITNSEEIA    211 - 280
FYNGNKREKQTVHSVFRKLVEHLHNFILFRFSMGFIDSIIAKYLATVVGYLVVSRPFLDLSHPRHLKSTH    281 - 350
SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEG    351 - 420
VQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGPNGCGKSSLFRVLGELW    421 - 490
PLFGGRLTKPERGKLFYVPQRPYMTLGTLRDQVIYPDGREDQKRKGISDLVLKEYLDNVQLGHILEREGG    491 - 560
WDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSAVSVDVEGYIYSHCRKVGITLFTVSHRKSLW    561 - 630
KHHEYYLHMDGRGNYEFKQITEDTVEFGS                                             631 - 659
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25802834 2015 Immunohistological analysis of ABCD3 expression in Caucasian and African American prostate tumors.
25168382 2015 A novel bile acid biosynthesis defect due to a deficiency of peroxisomal ABCD3.
24333844 2014 A role for the human peroxisomal half-transporter ABCD3 in the oxidation of dicarboxylic acids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
21102411 2010 Structural basis for docking of peroxisomal membrane protein carrier Pex19p onto its receptor Pex3p.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...