Property Summary

NCBI Gene PubMed Count 49
PubMed Score 64.15
PubTator Score 60.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Adrenoleukodystrophy 29 6.292 3.1
Infantile Refsum disease 23 3.466 1.7

Expression

  Differential Expression (26)

Disease log2 FC p
aldosterone-producing adenoma -1.272 2.6e-02
Alzheimer's disease -1.200 3.7e-02
astrocytic glioma 1.500 1.5e-02
Astrocytoma, Pilocytic 1.100 1.5e-02
atypical teratoid / rhabdoid tumor 2.300 2.3e-05
Breast cancer 4.100 2.2e-02
breast carcinoma 1.100 9.1e-12
dermatomyositis 1.400 2.5e-04
ependymoma 1.700 3.6e-03
gastric cancer 1.100 3.8e-04
glioblastoma 1.100 1.7e-02
group 4 medulloblastoma 1.500 8.7e-03
interstitial cystitis -1.100 1.7e-03
intraductal papillary-mucinous adenoma (... 1.200 1.5e-02
invasive ductal carcinoma 1.700 8.1e-03
medulloblastoma, large-cell 2.600 3.7e-05
oligodendroglioma 1.100 3.0e-02
osteosarcoma 2.371 1.6e-03
ovarian cancer -1.200 9.1e-05
pancreatic ductal adenocarcinoma liver m... -1.621 1.4e-02
pediatric high grade glioma 1.800 1.4e-03
Pick disease -1.100 2.0e-03
progressive supranuclear palsy -1.200 1.7e-02
psoriasis 1.100 1.4e-03
ulcerative colitis -1.800 3.3e-06
Waldenstrons macroglobulinemia 1.182 5.8e-03

Gene RIF (22)

AA Sequence

MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQI      1 - 70
LKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKRYLLNFIAAMPLISLVN     71 - 140
NFLKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQDVEKFCNSVVDLYSNLSKP    141 - 210
FLDIVLYIFKLTSAIGAQGPASMMAYLVVSGLFLTRLRRPIGKMTITEQKYEGEYRYVNSRLITNSEEIA    211 - 280
FYNGNKREKQTVHSVFRKLVEHLHNFILFRFSMGFIDSIIAKYLATVVGYLVVSRPFLDLSHPRHLKSTH    281 - 350
SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEG    351 - 420
VQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGPNGCGKSSLFRVLGELW    421 - 490
PLFGGRLTKPERGKLFYVPQRPYMTLGTLRDQVIYPDGREDQKRKGISDLVLKEYLDNVQLGHILEREGG    491 - 560
WDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSAVSVDVEGYIYSHCRKVGITLFTVSHRKSLW    561 - 630
KHHEYYLHMDGRGNYEFKQITEDTVEFGS                                             631 - 659
//

Text Mined References (55)

PMID Year Title