Property Summary

NCBI Gene PubMed Count 620
PubMed Score 2094.77
PubTator Score 2266.31

Knowledge Summary

Patent (560,492)

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
astrocytoma 1493 4.17710187480014E-32
oligodendroglioma 2849 1.05344280988658E-21
atypical teratoid / rhabdoid tumor 4369 1.25323479627578E-7
medulloblastoma 1524 9.20505716635318E-7
glioblastoma 5572 1.49222311231853E-6
pilocytic astrocytoma 3086 2.43725183540931E-5
pediatric high grade glioma 2712 2.78178487417148E-5
ovarian cancer 8492 1.00564347009534E-4
ependymoma 2514 4.91521837854816E-4
primitive neuroectodermal tumor 3031 6.00105824301805E-4
medulloblastoma, large-cell 6234 7.56481670771768E-4
interstitial cystitis 2299 0.00146584835106022
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -3.300 0.000
ependymoma -3.200 0.000
oligodendroglioma -3.300 0.000
glioblastoma -4.900 0.000
medulloblastoma -4.700 0.000
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -5.000 0.001
primitive neuroectodermal tumor -4.300 0.001
Parkinson's disease -1.200 0.040
interstitial cystitis 1.100 0.001
pediatric high grade glioma -3.600 0.000
pilocytic astrocytoma -3.500 0.000
ovarian cancer -1.300 0.000

Synonym

Accession P28223 B2RAC5 B4DZ79 F5GWE8 Q5T8C0 5-HT-2
Symbols HTR2
5-HT2A

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

  TechDev Info (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (723)

PMID Text
26845861 The data on the distribution of allele and genotype frequencies of the HTR1A, HTR2A, and HTR1B genes can be used to determine the associations of the identified markers with various forms of human aggressive behavior.
26812280 Results of this investigation provide preliminary evidence that the combined analysis of CpG SNPs and methylation may be useful for investigating the genetic and epigenetic factors involved in suicidal behavior. Study did not find strong evidence for epigenetic changes in the serotonin 2A receptor associated with suicidal behavior.
26768715 Alternative Viewpoint Against Breast Cancer Based on Selective Serotonin Receptors 5HTR3A and 5HTR2A Antagonists that can Mediate Apoptosis in MCF-7 Cell Line
26758213 Allosteric signaling through an mGlu2 and 5-HT2A heteromeric receptor complex and its potential contribution to schizophrenia.
26738766 human HTR2A gene spans ~66 kilobases and consists of 7, rather than 4 exons; Furthermore, the revised human HTR2A-AS1 gene spans ~474 kilobases and consists of 18, rather than 3 exons
26544898 epistatic effects of 5HTR1A and 5HTR2A genes on suicidal behaviour were not significant
26261165 No significant association was found between SNPs in HTR1A (rs6295), HTR2A (rs6311 and rs6313) and SLC6A4 and response to escitalopram in patients with major depressive disorder
26234928 increased gene expression in peripheral blood mononuclear cells of asthma patients
26206285 results suggest that 5-HT signaling participates in regulation of overall islet hormone secretion in non- diabetic individuals and over-expression of HTR1D and HTR2A may either contribute to islet dysfunction in T2D
26075944 This meta-analysis does not support the previously suggested association between HTR2A 102T/C and attempted suicide in the general population, but in patients with schizophrenia, the C/C genotype may increase the risk of attempted suicide.
More...

AA Sequence

MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGCLSPSCLSLLH      1 - 70
LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYR     71 - 140
WPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPI    141 - 210
PVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLAS    211 - 280
FSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICK    281 - 350
ESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK    351 - 420
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV                       421 - 471
//

Text Mined References (626)

PMID Year Title
26845861 2015 [Comparative Analysis of Polymorphisms of the Serotonin Receptor Genes HTR1A, HTR2A, and HTR1B in Hadza and Datoga Males].
26812280 2016 Interaction between Methylation and CpG Single-Nucleotide Polymorphisms in the HTR2A Gene: Association Analysis with Suicide Attempt in Schizophrenia.
26768715 2015 Alternative Viewpoint Against Breast Cancer Based on Selective Serotonin Receptors 5HTR3A and 5HTR2A Antagonists that can Mediate Apoptosis in MCF-7 Cell Line.
26758213 2016 Allosteric signaling through an mGlu2 and 5-HT2A heteromeric receptor complex and its potential contribution to schizophrenia.
26738766 2016 Genomic structure and expression of the human serotonin 2A receptor gene (HTR2A) locus: identification of novel HTR2A and antisense (HTR2A-AS1) exons.
26544898 2016 The impact of serotonin receptor 1A and 2A gene polymorphisms and interactions on suicide attempt and suicide risk in depressed patients with insufficient response to treatment--a European multicentre study.
26261165 2015 Association of serotonin transporter (SLC6A4) & receptor (5HTR1A, 5HTR2A) polymorphisms with response to treatment with escitalopram in patients with major depressive disorder: A preliminary study.
26234928 2015 Investigation of 5-HT2A gene expression in PBMCs of patients with allergic asthma.
26206285 2015 Altered serotonin (5-HT) 1D and 2A receptor expression may contribute to defective insulin and glucagon secretion in human type 2 diabetes.
26075944 2015 Association of the HTR2A 102T/C polymorphism with attempted suicide: a meta-analysis.
More...