Property Summary

Ligand Count 2,014
NCBI Gene PubMed Count 641
PubMed Score 2152.82
PubTator Score 2266.31

Knowledge Summary

Patent (560,492)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 0.9
substance-related disorder 162 0.0 1.8
Disease Target Count
Alcohol dependence 107

Expression

  Differential Expression (13)

Disease log2 FC p
Parkinson's disease -1.200 4.0e-02
adult high grade glioma -3.600 1.3e-03
astrocytic glioma -2.900 1.1e-03
Astrocytoma, Pilocytic -3.400 5.1e-05
atypical teratoid / rhabdoid tumor -4.300 1.1e-07
ependymoma -2.900 1.2e-03
glioblastoma -3.300 1.6e-07
group 3 medulloblastoma -4.100 4.4e-03
interstitial cystitis 1.100 1.5e-03
medulloblastoma, large-cell -4.900 3.0e-04
oligodendroglioma -2.000 5.1e-03
ovarian cancer -1.300 1.0e-04
primitive neuroectodermal tumor -3.800 9.1e-04

Gene RIF (742)

AA Sequence

MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGCLSPSCLSLLH      1 - 70
LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYR     71 - 140
WPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPI    141 - 210
PVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLAS    211 - 280
FSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICK    281 - 350
ESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK    351 - 420
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV                       421 - 471
//

Text Mined References (648)

PMID Year Title