Property Summary

NCBI Gene PubMed Count 620
Grant Count 781
R01 Count 429
Funding $112,108,951.02
PubMed Score 2094.77
PubTator Score 2266.31

Knowledge Summary

Patent (560,492)

TINX Plot

  Disease Relevance (91)

Disease Z-score Confidence
Schizophrenia 501 6.914 3.5
obsessive-compulsive disorder 34 5.499 2.7
Major Depressive Disorder 106 5.297 2.6
Bipolar Disorder 266 5.177 2.6
Panic disorder 55 4.734 2.4
Schizoaffective disorder 33 4.455 2.2
Hypoactive sexual desire disorder 9 4.411 2.2
Anorexia nervosa 59 4.349 2.2
Alcohol dependence 107 4.303 2.2
Seasonal affective disorder 25 4.124 2.1
Attention deficit hyperactivity disorder 156 4.035 2.0
Personality disorder 25 3.973 2.0
Parkinson's disease 364 3.97 2.0
Generalized anxiety disorder 29 3.881 1.9
Progressive multifocal leukoencephalopat... 24  3.79 1.9
Autistic Disorder 320 3.781 1.9
Migraine 79 3.735 1.9
Bulimia nervosa 15 3.687 1.8
Drug psychosis 6 3.684 1.8
Substance abuse 55 3.515 1.8
Gilles de la Tourette syndrome 47 3.471 1.7
Dementia 129 3.395 1.7
Hyperprolactinemia 22 3.377 1.7
Alzheimer's disease 644 3.224 1.6
Obstructive sleep apnea 28 3.159 1.6
Melancholia 12 3.107 1.6
Bruxism 19 3.031 1.5
post-traumatic stress disorder 45 3.021 1.5
Acute intermittent porphyria 14
Agitation associated with Bipolar Mania 5
Agitation associated with Schizophrenia 5
Alcoholic Intoxication, Chronic 41
Allergic conjunctivitis 25
Allergic rhinitis 91
Angioedema 36
Basal Ganglia Diseases 12
Bipolar affective disorder, current epis... 6 
Bipolar affective disorder, current epis... 13 
Bipolar disorder in remission 19
Carcinoma 2,147 1.0
Chronic Obstructive Airway Disease 47
Chronic schizophrenia 4
Chronic thromboembolic pulmonary hyperte... 4 
Cocaine-Related Disorders 88
Depression Treatment Adjunct 5
Dermatographic urticaria 6
Disruptive behavior disorder 3
Dyskinetic syndrome 6
Fever 34
General anesthesia 53
Hyperactive behavior 31
Hyperalgesia 71
Infantile autism 4
Intra-Operative Nausea and Vomiting 2
Intractable Hiccups 3
Itching of skin 19
Lack or loss of sexual desire 3
Metabolic Diseases 9
Migraine Disorders 26
Mixed bipolar I disorder 9
Nasal congestion 24
Nasal discharge 26
Nausea 9
Nausea and vomiting 6
Obesity 616
Post-Operative Nausea and Vomiting 4
Pre-Op Apprehension 10
Psychotic Disorders 20
Psychotic disorder 6
Sneezing 11
Spasticity 26
Suicidal Behavior in Schizoaffective Dis... 2 
Suicidal Behavior in Schizophrenia 2
Tetanus Adjunct Treatment 8
Treatment-Resistant Schizophrenia 3
Urticaria 53
Vomiting 9
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
ependymoma 2,514
glioblastoma 5,572
interstitial cystitis 2,299
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
ovarian cancer 8,484
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primitive neuroectodermal tumor 3,031
pulmonary arterial hypertension 36
substance-related disorder 105 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -3.300 0.000
ependymoma -3.200 0.000
oligodendroglioma -3.300 0.000
glioblastoma -4.900 0.000
medulloblastoma -4.700 0.000
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -5.000 0.001
primitive neuroectodermal tumor -4.300 0.001
Parkinson's disease -1.200 0.040
interstitial cystitis 1.100 0.001
pediatric high grade glioma -3.600 0.000
pilocytic astrocytoma -3.500 0.000
ovarian cancer -1.300 0.000

Synonym

Accession P28223 B2RAC5 B4DZ79 F5GWE8 Q5T8C0 5-HT-2
Symbols HTR2
5-HT2A

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (723)

PMID Text
26845861 The data on the distribution of allele and genotype frequencies of the HTR1A, HTR2A, and HTR1B genes can be used to determine the associations of the identified markers with various forms of human aggressive behavior.
26812280 Results of this investigation provide preliminary evidence that the combined analysis of CpG SNPs and methylation may be useful for investigating the genetic and epigenetic factors involved in suicidal behavior. Study did not find strong evidence for epigenetic changes in the serotonin 2A receptor associated with suicidal behavior.
26768715 Alternative Viewpoint Against Breast Cancer Based on Selective Serotonin Receptors 5HTR3A and 5HTR2A Antagonists that can Mediate Apoptosis in MCF-7 Cell Line
26758213 Allosteric signaling through an mGlu2 and 5-HT2A heteromeric receptor complex and its potential contribution to schizophrenia.
26738766 human HTR2A gene spans ~66 kilobases and consists of 7, rather than 4 exons; Furthermore, the revised human HTR2A-AS1 gene spans ~474 kilobases and consists of 18, rather than 3 exons
26544898 epistatic effects of 5HTR1A and 5HTR2A genes on suicidal behaviour were not significant
26261165 No significant association was found between SNPs in HTR1A (rs6295), HTR2A (rs6311 and rs6313) and SLC6A4 and response to escitalopram in patients with major depressive disorder
26234928 increased gene expression in peripheral blood mononuclear cells of asthma patients
26206285 results suggest that 5-HT signaling participates in regulation of overall islet hormone secretion in non- diabetic individuals and over-expression of HTR1D and HTR2A may either contribute to islet dysfunction in T2D
26075944 This meta-analysis does not support the previously suggested association between HTR2A 102T/C and attempted suicide in the general population, but in patients with schizophrenia, the C/C genotype may increase the risk of attempted suicide.
More...

AA Sequence

MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGCLSPSCLSLLH      1 - 70
LQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYR     71 - 140
WPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPI    141 - 210
PVFGLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLAS    211 - 280
FSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICK    281 - 350
ESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK    351 - 420
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV                       421 - 471
//

Text Mined References (626)

PMID Year Title
26845861 2015 [Comparative Analysis of Polymorphisms of the Serotonin Receptor Genes HTR1A, HTR2A, and HTR1B in Hadza and Datoga Males].
26812280 2016 Interaction between Methylation and CpG Single-Nucleotide Polymorphisms in the HTR2A Gene: Association Analysis with Suicide Attempt in Schizophrenia.
26768715 2015 Alternative Viewpoint Against Breast Cancer Based on Selective Serotonin Receptors 5HTR3A and 5HTR2A Antagonists that can Mediate Apoptosis in MCF-7 Cell Line.
26758213 2016 Allosteric signaling through an mGlu2 and 5-HT2A heteromeric receptor complex and its potential contribution to schizophrenia.
26738766 2016 Genomic structure and expression of the human serotonin 2A receptor gene (HTR2A) locus: identification of novel HTR2A and antisense (HTR2A-AS1) exons.
26544898 2016 The impact of serotonin receptor 1A and 2A gene polymorphisms and interactions on suicide attempt and suicide risk in depressed patients with insufficient response to treatment--a European multicentre study.
26261165 2015 Association of serotonin transporter (SLC6A4) & receptor (5HTR1A, 5HTR2A) polymorphisms with response to treatment with escitalopram in patients with major depressive disorder: A preliminary study.
26234928 2015 Investigation of 5-HT2A gene expression in PBMCs of patients with allergic asthma.
26206285 2015 Altered serotonin (5-HT) 1D and 2A receptor expression may contribute to defective insulin and glucagon secretion in human type 2 diabetes.
26075944 2015 Association of the HTR2A 102T/C polymorphism with attempted suicide: a meta-analysis.
More...