Property Summary

NCBI Gene PubMed Count 175
Grant Count 307
R01 Count 178
Funding $39,562,488.97
PubMed Score 1050.36
PubTator Score 591.09

Knowledge Summary

Patent (24,886)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.087 0.000
medulloblastoma, large-cell 1.200 0.000

Synonym

Accession P28222 Q4VAY7 5-HT-1B
Symbols S12
5-HT1B
HTR1D2
HTR1DB
5-HT-1B
5-HT1DB
5-HT-1D-beta

Gene

PANTHER Protein Class (2)

PDB

2G1X   4IAQ   4IAR  

  TechDev Info (1)

Gene RIF (159)

PMID Text
26845861 The data on the distribution of allele and genotype frequencies of the HTR1A, HTR2A, and HTR1B genes can be used to determine the associations of the identified markers with various forms of human aggressive behavior.
26428549 large scale neural activation differences in the inferior and medial frontal and temporal/parietal regions of the response inhibition network between the different variants of both the HTR1B and 5HTT genes; activation in these regions was significantly associated with stop-task performance, but not with ADHD diagnosis or severity
26254863 Results from Parkinson's disease patients and MPTP-lesioned monkeys argue in favor of a contribution of 5-HT1B receptors in the pathophysiology of levodopa-induced motor complications
25993020 Serotonin 1B Receptor Gene (HTR1B) Methylation as a Risk Factor for Callous-Unemotional Traits in Antisocial Boys
25652393 The interaction between two major serotonergic structures involved in serotonin release, the SERT and 5-HT1B receptor, results in a modification of the inhibitory serotonergic tone mediated via 5-HT1A receptors.
25268648 Down-regulation of 5-HT1B and 5-HT1D receptors inhibits proliferation, clonogenicity and invasion of human pancreatic cancer cells.
25170871 5-HT1B- and 5-HT1D-mediated signaling play an important role in the regulation of the proliferative and invasive phenotype of pancreatic cancer cells.
24571444 HTR1B SNPs significantly associate with early-onset obsessive compulsive disorder.
24433854 reductions in 5-HT1B availability found in this study suggest that 5-HT1B receptors may contribute to the etiology or expression of cocaine dependence and potentially represent a target for medication development.
24126162 Low level of 5-HT(1B)receptors in limbic system corelates to decreased serotonin function in patients with Parkinson disease.(review)
More...

AA Sequence

MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFV      1 - 70
IATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHL     71 - 140
CVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTV    141 - 210
YSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSE    211 - 280
SGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI    281 - 350
FDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS                                  351 - 390
//

Text Mined References (181)

PMID Year Title
26845861 2015 [Comparative Analysis of Polymorphisms of the Serotonin Receptor Genes HTR1A, HTR2A, and HTR1B in Hadza and Datoga Males].
26526368 2015 Lack of association of polymorphisms in six candidate genes in colombian adhd patients.
26428549 2015 Variation in serotonin neurotransmission genes affects neural activation during response inhibition in adolescents and young adults with ADHD and healthy controls.
26352193 2015 Alcohol Dependence and Genetic Variability in the Serotonin Pathway among Currently and Formerly Alcohol-Dependent Males.
26254863 2015 Contribution of brain serotonin subtype 1B receptors in levodopa-induced motor complications.
26231449 2015 Systems pharmacology to decipher the combinational anti-migraine effects of Tianshu formula.
26123080 2015 Association between the polymorphism of C861G (rs6296) in the serotonin 1B receptor gene and Tourette syndrome in Han Chinese people.
25993020 2015 Serotonin 1B Receptor Gene (HTR1B) Methylation as a Risk Factor for Callous-Unemotional Traits in Antisocial Boys.
25871906 2015 A Sex-Specific MicroRNA-96/5-Hydroxytryptamine 1B Axis Influences Development of Pulmonary Hypertension.
25841787 2015 5-HT1B and other related serotonergic proteins are altered in APPswe mutation.
More...