Property Summary

Ligand Count 520
NCBI Gene PubMed Count 182
PubMed Score 1068.36
PubTator Score 591.09

Knowledge Summary

Patent (24,886)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 6.6e-05
osteosarcoma 1.087 8.9e-05

Gene RIF (165)

AA Sequence

MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFV      1 - 70
IATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHL     71 - 140
CVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTV    141 - 210
YSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSE    211 - 280
SGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAI    281 - 350
FDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS                                  351 - 390
//

Text Mined References (188)

PMID Year Title