Property Summary

NCBI Gene PubMed Count 49
Grant Count 35
R01 Count 9
Funding $7,630,559.5
PubMed Score 348.00
PubTator Score 184.96

Knowledge Summary

Patent (8,267)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.600 0.000
diabetes mellitus 1.600 0.001

 MGI Term (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2

Gene RIF (36)

PMID Text
26214021 Data show that 5-hydroxytryptamine receptor (5-HT1DR) played an important role in cell invasion via Axin1/beta-catenin/matrix metalloproteinase 7 (MMP-7) pathway.
26206285 results suggest that 5-HT signaling participates in regulation of overall islet hormone secretion in non- diabetic individuals and over-expression of HTR1D and HTR2A may either contribute to islet dysfunction in T2D
25268648 Down-regulation of 5-HT1B and 5-HT1D receptors inhibits proliferation, clonogenicity and invasion of human pancreatic cancer cells.
25170871 5-HT1B- and 5-HT1D-mediated signaling play an important role in the regulation of the proliferative and invasive phenotype of pancreatic cancer cells.
22107845 study identified the presence of genetic association at chromosome 1p36 with migraine with aura (P=0.045, Bonferroni corrected): the locus encoding the 5HT(1D) receptor gene
21079607 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20946355 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20633049 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20545463 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVLTTILLTRKLH      1 - 70
TPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAI     71 - 140
TDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPS    141 - 210
VLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIK    211 - 280
LADSALERKRISAARERKATKILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSL    281 - 350
INPIIYTVFNEEFRQAFQKIVPFRKAS                                               351 - 377
//

Text Mined References (53)

PMID Year Title
26214021 2015 5-hydroxytryptamine receptor (5-HT1DR) promotes colorectal cancer metastasis by regulating Axin1/?-catenin/MMP-7 signaling pathway.
26206285 2015 Altered serotonin (5-HT) 1D and 2A receptor expression may contribute to defective insulin and glucagon secretion in human type 2 diabetes.
25268648 2014 Down-regulation of 5-HT1B and 5-HT1D receptors inhibits proliferation, clonogenicity and invasion of human pancreatic cancer cells.
25170871 2014 Down-regulation of 5-HT1B and 5-HT1D receptors inhibits proliferation, clonogenicity and invasion of human pancreatic cancer cells.
22107845 2012 Chromosome 1p36 in migraine with aura: association study of the 5HT(1D) locus.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
20946355 2011 Association study in eating disorders: TPH2 associates with anorexia nervosa and self-induced vomiting.
20945968 2011 Serotonin receptors - from molecular biology to clinical applications.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20633049 2010 Anxiety and depression in children and adults: influence of serotonergic and neurotrophic genes?
More...