Property Summary

NCBI Gene PubMed Count 57
Grant Count 29
R01 Count 21
Funding $1,571,019
PubMed Score 163.63
PubTator Score 138.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Gene RIF (32)

PMID Text
24852519 The absence of GSTM1 and GSTT1 genes increases the risk of lung cancer because of radon exposure.
24399650 demonstrated that the GSTM1 and GSTT1 null genotype may be associated with an increased risk of Hepatocellular carcinoma (HCC) and that individuals having the combination of both defective GST genotypes may be more susceptible to developing HCC
24048194 the absence of GSTM1 activity can be compensated for by the overexpression of GSTM2.
23675469 High expression of GSTM1 and GSTM4, along with increased endogenous reduced glutathione levels, help to maintain a more reduced state of cytochrome c which decreases apoptosis thus contributing to methotrexate resistance in human MCF7 breast cancer cells.
21455499 it was noted that the alpha-6 helix of GST-C plays a stabilising role in the fold of this domain. By destabilising the conformation of GST-C, an increase in cell translocation efficiency of up to approximately 2-fold was observed.
21454564 analysis of active-site residues and modulation of catalytic functions in GST-M2
21268265 High GSTM2 is associated with mesenchymal stem-like cells derived from ovarian teratoma.
21246532 GST-M2 exhibited high frequency of promoter hypermethylation in lung cancer cells, CpG hypermethylation abated Sp1 binding to the GST-M2 promoter in lung cancer
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKI      1 - 70
TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQ     71 - 140
FLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFT    141 - 210
KMAVWGNK                                                                  211 - 218
//

Text Mined References (61)

PMID Year Title
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24852519 2014 Genetic susceptibility, residential radon, and lung cancer in a radon prone area.
24399650 2014 Quantitative assessment of the effect of glutathione S-transferase genes GSTM1 and GSTT1 on hepatocellular carcinoma risk.
24048194 2013 Functional compensation of glutathione S-transferase M1 (GSTM1) null by another GST superfamily member, GSTM2.
23675469 2013 The redox state of cytochrome c modulates resistance to methotrexate in human MCF7 breast cancer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22406107 2012 The inhibitory glutathione transferase M2-2 binding site is located in divergent region 3 of the cardiac ryanodine receptor.
21455499 2011 A structural basis for cellular uptake of GST-fold proteins.
21454564 2011 Cys-X scanning for expansion of active-site residues and modulation of catalytic functions in a glutathione transferase.
More...