Property Summary

Ligand Count 226
NCBI Gene PubMed Count 72
PubMed Score 29.20
PubTator Score 47.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Disease Target Count P-value
group 3 medulloblastoma 4104 6.2e-05
ovarian cancer 8520 6.2e-05
psoriasis 6694 1.3e-04
diabetes mellitus 1728 1.3e-03
lung cancer 4740 2.6e-03

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.800 1.3e-03
group 3 medulloblastoma 1.200 6.2e-05
lung cancer 1.100 2.6e-03
Multiple myeloma 1.427 4.1e-04
ovarian cancer 1.900 6.2e-05
psoriasis 1.200 1.3e-04

Protein-protein Interaction (2)

Gene RIF (43)

AA Sequence

MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHG      1 - 70
VIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASK     71 - 140
LLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ    141 - 210
AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP                     211 - 263
//

Text Mined References (90)

PMID Year Title