Property Summary

NCBI Gene PubMed Count 70
PubMed Score 29.68
PubTator Score 47.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Myocardial Ischemia 169
Disease Target Count P-value
lung cancer 4473 3.45425004803289E-5
group 3 medulloblastoma 2254 6.20094641976975E-5
ovarian cancer 8492 6.21653473524304E-5
psoriasis 6685 1.34558812656305E-4
diabetes mellitus 1663 0.0012839597699122

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.427 0.000
psoriasis 1.200 0.000
lung cancer 1.700 0.000
diabetes mellitus -1.800 0.001
group 3 medulloblastoma 1.200 0.000
ovarian cancer 1.900 0.000

Synonym

Accession P28074 B2R4N9 B4DUM9 D3DS43 E9PAV2 Q16242 Q6PEW2 Q7Z3B5 Q86T01 Q9TNN9
Symbols X
MB1
LMPX

Gene

PDB

5GJQ   5GJR   5L4G   4R3O   4R67   5A0Q   5LE5   5LEX   5LEY   5LEZ   5LF0   5LF1   5LF3   5LF4   5LF6   5LF7  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (41)

PMID Text
24627483 Data indicate that proteasomal subunit X PSMB5 is a target of signal transducer and activator of transcription 3 (STAT3).
24393841 critical role of PSMB5 in 20S proteasome-mediated protection against replicative senescence, pointing to a possible strategy for maintaining the integrity of culture-expanded bone marrow stromal cells by manipulating the expression of PSMB5
23018640 Data indicate that treatment-emergent resistance to single-agent bortezomib was independent of variants in the proteasome genes PSMB1, PSMB5, PSMB6, PSMB8, PSMB9, and PSMB10.
22781773 The expression of proteasome beta5 decreases markedly in human atherosclerotic plaques.
22523338 Letter/Case Reports: proteasome subunit beta5t is expressed in cervical ectopic thymoma.
21978467 PSMB5 overexpression is associated with Bortezomib resistance in myeloma.
21920470 No mutations or differences in PSMB5 mRNA expression were seen before bortezomib treatment in 3 multiple myeloma patients, but after treatment, 1 patient showed PSMB5 upregulation associated with bortezomib resistance.
21289309 CDK5 regulation of proteasome subunit PSMB5 was identified as a probable route to antineoplastic drug sensitization.
20555361 Expression of mutated PSMB5 was associated with the prevention of the accumulation of unfolded proteins
19426847 Mutations of the PSMB5 gene resulting in substitutions of Ala49 and Ala50 of PSMB5 protein can confer varying bortezomib resistance
More...

AA Sequence

MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHG      1 - 70
VIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASK     71 - 140
LLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ    141 - 210
AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP                     211 - 263
//

Text Mined References (79)

PMID Year Title
24627483 2014 Regulation of PSMB5 protein and ? subunits of mammalian proteasome by constitutively activated signal transducer and activator of transcription 3 (STAT3): potential role in bortezomib-mediated anticancer therapy.
24393841 2014 Ameliorating replicative senescence of human bone marrow stromal cells by PSMB5 overexpression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23018640 2012 Sequence analysis of ?-subunit genes of the 20S proteasome in patients with relapsed multiple myeloma treated with bortezomib or dexamethasone.
22781773 2012 [Expression of proteasome ?5 subunit in human atherosclerotic plaque].
22523338 2012 Proteasome subunit ?5t expression in cervical ectopic thymoma.
21978467 2012 Bortezomib resistance in a myeloma cell line is associated to PSM?5 overexpression and polyploidy.
21920470 2011 Upregulated expression of the PSMB5 gene may contribute to drug resistance in patient with multiple myeloma when treated with bortezomib-based regimen.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...