Property Summary

NCBI Gene PubMed Count 45
PubMed Score 10.57
PubTator Score 5.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.399 0.003
psoriasis 1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.876 0.009
lung cancer 1.200 0.000
non primary Sjogren syndrome sicca 1.200 0.030
ovarian cancer 2.600 0.000

Synonym

Accession P28072 Q96J55
Symbols Y
LMPY
DELTA

Gene

PDB

5GJQ   5GJR   5L4G   4R3O   4R67   5A0Q   5LE5   5LEX   5LEY   5LEZ   5LF0   5LF1   5LF3   5LF4   5LF6   5LF7  

Gene RIF (32)

PMID Text
23018640 Data indicate that treatment-emergent resistance to single-agent bortezomib was independent of variants in the proteasome genes PSMB1, PSMB5, PSMB6, PSMB8, PSMB9, and PSMB10.
22190034 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20661134 results indicate ZAG as a possible predictive marker of Gleason grade. The inverse association between grade and tissue expression with a rising serum protein level is similar to that seen with prostate-specific antigen. In addition, the results for both ZAG and PSMB-6 highlight the challenges in trying to associate the protein levels in serum with tissue expression
18854154 Knockdown of proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
14614829 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14564014 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14557625 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14550573 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14550573 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTP      1 - 70
IHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQ     71 - 140
EGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRL    141 - 210
AAIAESGVERQVLLGDQIPKFAVATLPPA                                             211 - 239
//

Text Mined References (50)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23018640 2012 Sequence analysis of ?-subunit genes of the 20S proteasome in patients with relapsed multiple myeloma treated with bortezomib or dexamethasone.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20661134 2010 Evaluation of Zinc-?-2-Glycoprotein and Proteasome Subunit ?-Type 6 Expression in Prostate Cancer Using Tissue Microarray Technology.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...