Property Summary

NCBI Gene PubMed Count 45
PubMed Score 10.57
PubTator Score 5.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.87230815851581E-6
psoriasis 6685 1.17367245740043E-4
lung cancer 4473 1.98591445289888E-4
Multiple myeloma 1328 0.0026278158212421
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00939596855255239
non primary Sjogren syndrome sicca 840 0.0304569767622266

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.399 0.003
psoriasis 1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.876 0.009
lung cancer 1.200 0.000
non primary Sjogren syndrome sicca 1.200 0.030
ovarian cancer 2.600 0.000

Synonym

Accession P28072 Q96J55
Symbols Y
LMPY
DELTA

Gene

PDB

5GJQ   5GJR   5L4G   4R3O   4R67   5A0Q   5LE5   5LEX   5LEY   5LEZ   5LF0   5LF1   5LF3   5LF4   5LF6   5LF7  

  Ortholog (11)

Gene RIF (28)

PMID Text
23018640 Data indicate that treatment-emergent resistance to single-agent bortezomib was independent of variants in the proteasome genes PSMB1, PSMB5, PSMB6, PSMB8, PSMB9, and PSMB10.
22190034 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20661134 results indicate ZAG as a possible predictive marker of Gleason grade. The inverse association between grade and tissue expression with a rising serum protein level is similar to that seen with prostate-specific antigen. In addition, the results for both ZAG and PSMB-6 highlight the challenges in trying to associate the protein levels in serum with tissue expression
18854154 Knockdown of proteasome (prosome, macropain) subunit, beta type, 6 (PSMB6) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
14614829 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14564014 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14557625 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14550573 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14528301 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14528300 HIV-1 gp120 is identified to have a physical interaction with proteasome subunit, beta type, 6 (PSMB6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTP      1 - 70
IHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQ     71 - 140
EGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRL    141 - 210
AAIAESGVERQVLLGDQIPKFAVATLPPA                                             211 - 239
//

Text Mined References (50)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23018640 2012 Sequence analysis of ?-subunit genes of the 20S proteasome in patients with relapsed multiple myeloma treated with bortezomib or dexamethasone.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20661134 2010 Evaluation of Zinc-?-2-Glycoprotein and Proteasome Subunit ?-Type 6 Expression in Prostate Cancer Using Tissue Microarray Technology.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...