Property Summary

NCBI Gene PubMed Count 45
PubMed Score 10.87
PubTator Score 5.43

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.200 2.0e-04
Multiple myeloma 1.399 2.6e-03
non primary Sjogren syndrome sicca 1.200 3.0e-02
ovarian cancer 2.600 2.9e-06
pancreatic ductal adenocarcinoma liver m... -1.876 9.4e-03
psoriasis 1.300 1.2e-04

Gene RIF (28)

AA Sequence

MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTP      1 - 70
IHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQ     71 - 140
EGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRL    141 - 210
AAIAESGVERQVLLGDQIPKFAVATLPPA                                             211 - 239
//

Text Mined References (59)

PMID Year Title