Property Summary

NCBI Gene PubMed Count 57
PubMed Score 13.72
PubTator Score 13.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.479 0.011
Multiple myeloma 2.055 0.001
psoriasis -2.000 0.000
lung cancer 1.100 0.002
non primary Sjogren syndrome sicca 1.300 0.045
ovarian cancer 2.000 0.001

Synonym

Accession P28070 B2R9L3 P31148 Q5SZS5 Q6IBI4 Q969L6
Symbols HN3
HsN3
PROS26
PROS-26

Gene

PDB

5GJQ   5GJR   5L4G   4R3O   4R67   5A0Q   5LE5   5LEX   5LEY   5LEZ   5LF0   5LF1   5LF3   5LF4   5LF6   5LF7  

Gene RIF (38)

PMID Text
25656574 Taken together, our results demonstrated that PSMB4 regulated MM cell growth in part by activating NF-kappaB-miR-21 signaling, which may represent promising targets for novel specific therapies.
24291262 Data indicate that recruitment of proteasomes into mutant huntingtin (mHTT) protein initiated inclusion bodies (IBs) was observed when the PSMB4-GFP was co-expressed with mHTT.
23559827 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
23026050 proteasome subunit beta type 4 (PSMB4), the beta7 subunit of the 20S core complex, was identified as a direct binding partner of CRBN.
20810900 While 26 proteasome dysfunction is observed in Parkinson's disease (PD), diverse mutations in the parkin gene are linked to early-onset autosomal-recessive forms of familial PD.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18504423 Observational study of gene-disease association. (HuGE Navigator)
14614829 HIV-1 Nef was found to markedly downregulate intracellular levels of both a co-expressed HsN3 and the endogenous simian homologue, suggesting Nef may alter proteasome function in infected cells
More...

AA Sequence

MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAAD      1 - 70
MLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRA     71 - 140
MYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEA    141 - 210
RDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE                    211 - 264
//

Text Mined References (71)

PMID Year Title
26524591 2015 Additive loss-of-function proteasome subunit mutations in CANDLE/PRAAS patients promote type I IFN production.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25656574 2015 PSMB4 promotes multiple myeloma cell growth by activating NF-?B-miR-21 signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24291262 2014 Dynamic recruitment of active proteasomes into polyglutamine initiated inclusion bodies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23026050 2012 Cereblon inhibits proteasome activity by binding to the 20S core proteasome subunit beta type 4.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...