Property Summary

NCBI Gene PubMed Count 59
PubMed Score 14.21
PubTator Score 13.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.100 1.5e-03
Multiple myeloma 2.055 8.6e-04
non primary Sjogren syndrome sicca 1.300 4.5e-02
ovarian cancer 2.000 9.0e-04
psoriasis -2.000 2.3e-05
Waldenstrons macroglobulinemia 1.479 1.1e-02

Gene RIF (36)

AA Sequence

MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAAD      1 - 70
MLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRA     71 - 140
MYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEA    141 - 210
RDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE                    211 - 264
//

Text Mined References (82)

PMID Year Title