Property Summary

NCBI Gene PubMed Count 102
Grant Count 20
R01 Count 11
Funding $969,543.27
PubMed Score 172.38
PubTator Score 377.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer -6.000 0.000

Gene RIF (60)

PMID Text
26743473 Data identify silent subtype 3 adenomas as aggressive monomorphous plurihormonal adenomas of Pit-1 lineage that may be associated with hyperthyroidism, acromegaly or galactorrhea and amenorrhea.
25527274 Pit-1 regulates MMP-1 and MMP-13, and that inhibition of MMP-13 blocked invasiveness to lung in Pit-1-overexpressed breast cancer cells.
25500790 investigated the specific mutations in PROP1, POU1F1, LHX3, and HESX1 genes in patients with combined pituitary hormone deficiency (CPHD) in Turkey
24937538 These results suggest that the anti-PIT-1 antibody is not a cause but a marker of anti-PIT-1 antibody syndrome, in which cytotoxic T lymphocytes play a pivotal role in the pathogenesis.
22638072 New target genes of POU1F1 and downstream networks controlled by this factor.
22199144 Expression analysis of HMGA1, HMGA2 and PIT1 in human pituitary adenomas of different histological types revealed a direct correlation between PIT1 and HMGA expression levels.
22094313 HSII confers robust POU1F1-dependent activation of hGH-N in this system.
21761366 Data show no mutations in HESX1, PROP1, and POU1F1 genes, seven different mutations in CTNNB1 in 8/16 patients, and hyperexpression of miR-150.
21722153 This is the first report of a mutation at the exon 2 donor splice site of POU1F1, affecting TAD-R2.
21521297 study, which identifies a novel loss-of-function mutation in POU1F1, describes the phenotype of a rare condition in a patient followed from the first weeks of life to adulthood
More...

AA Sequence

MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVM      1 - 70
AGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFK     71 - 140
VRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGA    141 - 210
NERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSL    211 - 280
FSISKEHLECR                                                               281 - 291
//

Text Mined References (105)

PMID Year Title
26743473 2016 Silent subtype 3 pituitary adenomas are not always silent and represent poorly differentiated monomorphous plurihormonal Pit-1 lineage adenomas.
26612202 2016 Functional characterization of a human POU1F1 mutation associated with isolated growth hormone deficiency: a novel etiology for IGHD.
25527274 2014 Cancer progression by breast tumors with Pit-1-overexpression is blocked by inhibition of metalloproteinase (MMP)-13.
25500790 2015 Molecular analysis of PROP1, POU1F1, LHX3, and HESX1 in Turkish patients with combined pituitary hormone deficiency: a multicenter study.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24937538 2014 Involvement of PIT-1-reactive cytotoxic T lymphocytes in anti-PIT-1 antibody syndrome.
22638072 2012 Research resource: A genome-wide study identifies potential new target genes for POU1F1.
22199144 2012 PIT1 upregulation by HMGA proteins has a role in pituitary tumorigenesis.
22094313 2012 POU1F1-mediated activation of hGH-N by deoxyribonuclease I hypersensitive site II of the human growth hormone locus control region.
More...