Property Summary

NCBI Gene PubMed Count 78
PubMed Score 0.00
PubTator Score 30.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.71024059577338E-33
Duchenne muscular dystrophy 602 6.870050635559E-10
ulcerative colitis 2087 2.34798373874277E-9
non-small cell lung cancer 2798 4.90883349436803E-9
pilocytic astrocytoma 3086 1.54858774121632E-7
tuberculosis 1563 3.91620488726184E-6
lung cancer 4473 2.66253828210843E-5
ovarian cancer 8492 3.00338128856867E-5
active Crohn's disease 918 5.23306450124064E-5
invasive ductal carcinoma 2950 5.74325512538122E-5
primary Sjogren syndrome 789 1.56499208984585E-4
interstitial cystitis 2299 8.31323501588995E-4
glioblastoma 5572 0.00128737061191316
breast carcinoma 1614 0.00180711124357537
head and neck cancer and chronic obstructive pulmonary disease 237 0.002675105365561
osteosarcoma 7933 0.00920112870988304
subependymal giant cell astrocytoma 2287 0.0105670714624622
cutaneous lupus erythematosus 1056 0.0123896066969791
adult high grade glioma 2148 0.0175973468976185
esophageal adenocarcinoma 737 0.0195207517873976
adrenocortical carcinoma 1427 0.0200928930963324
Endometriosis 535 0.0386739168962845
Disease Target Count Z-score Confidence
Alopecia universalis 10 3.337 1.7

Expression

  Differential Expression (22)

Synonym

Accession P28068 O77936 Q13012 Q29751 Q58ZE2 Q5SNZ8 Q5STC4 Q9XRX2
Symbols RING7
D6S221E

Gene

PDB

4FQX   4GBX   4I0P   1HDM   2BC4  

  Ortholog (5)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (67)

PMID Text
26062997 This study provides novel insights into how HLA-DM efficiently catalyzes peptide loading during antigen presentation.
25008864 Data suggest that antigen processing by MHC class II HLA-DMB antigen is a target pathway in the pathogenesis of HIV-related Kaposi's sarcoma.
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
23260142 The structure of the HLA-DM-HLA-DR complex shows major rearrangements of the HLA-DR peptide-binding groove.
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22309257 DMA*01:01 (69.35%) and DMB*01:01 (52.5%) alleles were more frequent in Chinese Hans
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
More...

AA Sequence

MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLN      1 - 70
SLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGF     71 - 140
YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPG    141 - 210
LSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS                     211 - 263
//

Text Mined References (80)

PMID Year Title
26062997 2015 Evaluating the Role of HLA-DM in MHC Class II-Peptide Association Reactions.
25008864 2014 SNP screening of central MHC-identified HLA-DMB as a candidate susceptibility gene for HIV-related Kaposi's sarcoma.
23260142 2012 Crystal structure of the HLA-DM-HLA-DR1 complex defines mechanisms for rapid peptide selection.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22309257 2012 Analysis of HLA-DM polymorphisms in the Chinese Han population.
22247549 2012 Ubiquitination of human leukocyte antigen (HLA)-DM by different membrane-associated RING-CH (MARCH) protein family E3 ligases targets different endocytic pathways.
21622867 2011 Forced expression of HLA-DM at the surface of dendritic cells increases loading of synthetic peptides on MHC class II molecules and modulates T cell responses.
21131964 2011 HLA-DM captures partially empty HLA-DR molecules for catalyzed removal of peptide.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20408893 2010 DM influences the abundance of major histocompatibility complex class II alleles with low affinity for class II-associated invariant chain peptides via multiple mechanisms.
More...