Property Summary

NCBI Gene PubMed Count 79
PubMed Score 6.70
PubTator Score 30.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 3.480 5.2e-05
active ulcerative colitis 2.691 4.1e-04
adrenocortical carcinoma -1.170 2.0e-02
adult high grade glioma 1.200 1.8e-02
Astrocytoma, Pilocytic 1.700 1.2e-07
breast carcinoma 1.100 1.8e-03
cutaneous lupus erythematosus 1.100 1.2e-02
Duchenne muscular dystrophy 1.107 6.9e-10
Endometriosis -1.346 3.9e-02
esophageal adenocarcinoma 1.100 2.0e-02
glioblastoma 2.400 1.3e-03
head and neck cancer and chronic obstruc... 1.400 2.7e-03
interstitial cystitis 2.000 8.3e-04
invasive ductal carcinoma 1.787 5.7e-05
lung cancer -1.300 1.0e-02
lung carcinoma -2.700 2.7e-33
non-small cell lung cancer -1.215 4.9e-09
osteosarcoma -1.501 9.2e-03
ovarian cancer -1.200 5.4e-03
primary Sjogren syndrome 2.400 1.6e-04
subependymal giant cell astrocytoma 2.486 1.1e-02
tuberculosis 1.300 3.9e-06

Protein-protein Interaction (1)

Gene RIF (67)

AA Sequence

MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLN      1 - 70
SLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGF     71 - 140
YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPG    141 - 210
LSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS                     211 - 263
//

Text Mined References (81)

PMID Year Title