Property Summary

NCBI Gene PubMed Count 78
Grant Count 1
Funding $49,687.5
PubMed Score 0.00
PubTator Score 30.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Synonym

Accession P28068 O77936 Q13012 Q29751 Q58ZE2 Q5SNZ8 Q5STC4 Q9XRX2
Symbols RING7
D6S221E

Gene

 Grant Application (1)

PDB

4FQX   4GBX   4I0P   1HDM   2BC4  

Gene RIF (71)

PMID Text
26062997 This study provides novel insights into how HLA-DM efficiently catalyzes peptide loading during antigen presentation.
25008864 Data suggest that antigen processing by MHC class II HLA-DMB antigen is a target pathway in the pathogenesis of HIV-related Kaposi's sarcoma.
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
23260142 The structure of the HLA-DM-HLA-DR complex shows major rearrangements of the HLA-DR peptide-binding groove.
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22309257 DMA*01:01 (69.35%) and DMB*01:01 (52.5%) alleles were more frequent in Chinese Hans
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
More...

AA Sequence

MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLN      1 - 70
SLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGF     71 - 140
YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPG    141 - 210
LSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS                     211 - 263
//

Text Mined References (80)

PMID Year Title
26062997 2015 Evaluating the Role of HLA-DM in MHC Class II-Peptide Association Reactions.
25008864 2014 SNP screening of central MHC-identified HLA-DMB as a candidate susceptibility gene for HIV-related Kaposi's sarcoma.
23260142 2012 Crystal structure of the HLA-DM-HLA-DR1 complex defines mechanisms for rapid peptide selection.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22309257 2012 Analysis of HLA-DM polymorphisms in the Chinese Han population.
22247549 2012 Ubiquitination of human leukocyte antigen (HLA)-DM by different membrane-associated RING-CH (MARCH) protein family E3 ligases targets different endocytic pathways.
21622867 2011 Forced expression of HLA-DM at the surface of dendritic cells increases loading of synthetic peptides on MHC class II molecules and modulates T cell responses.
21131964 2011 HLA-DM captures partially empty HLA-DR molecules for catalyzed removal of peptide.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20408893 2010 DM influences the abundance of major histocompatibility complex class II alleles with low affinity for class II-associated invariant chain peptides via multiple mechanisms.
More...