Property Summary

NCBI Gene PubMed Count 53
PubMed Score 13.44
PubTator Score 11.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adult high grade glioma -1.900 8.7e-04
Alzheimer's disease -1.500 4.4e-02
astrocytic glioma -2.300 9.0e-03
Astrocytoma, Pilocytic -1.500 2.3e-04
atypical teratoid / rhabdoid tumor -2.900 5.9e-07
cystic fibrosis -1.400 1.4e-03
diabetes mellitus -1.400 2.1e-03
ependymoma -2.100 2.9e-02
gastric cancer 1.500 1.2e-03
glioblastoma -1.800 7.6e-05
group 3 medulloblastoma -1.300 3.6e-02
hepatocellular carcinoma 1.400 5.2e-06
intraductal papillary-mucinous adenoma (... 1.600 5.7e-03
intraductal papillary-mucinous carcinoma... 1.600 7.9e-03
intraductal papillary-mucinous neoplasm ... 1.700 3.2e-02
invasive ductal carcinoma 1.100 4.7e-04
lung cancer 1.600 1.7e-03
medulloblastoma, large-cell -3.200 9.5e-05
non-small cell lung cancer -1.359 6.9e-24
oligodendroglioma -2.200 1.9e-02
osteosarcoma -1.119 2.1e-02
ovarian cancer -1.300 6.9e-03
pancreatic ductal adenocarcinoma liver m... -1.683 3.7e-03
Pick disease -2.000 9.8e-04
pituitary cancer 1.600 5.9e-05
primitive neuroectodermal tumor -1.800 2.2e-03
psoriasis 1.700 1.8e-04
tuberculosis -1.100 9.8e-03
Waldenstrons macroglobulinemia 1.004 5.9e-03

Gene RIF (26)

AA Sequence

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI      1 - 70
DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVA     71 - 140
LLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKL    141 - 210
NATNIELATVQPGQNFHMFTKEELEEVIKDI                                           211 - 241
//

Text Mined References (73)

PMID Year Title