Property Summary

Ligand Count 7
NCBI Gene PubMed Count 86
PubMed Score 385.55
PubTator Score 284.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 2.767 4.7e-04
active ulcerative colitis 2.150 2.6e-03
adult high grade glioma 1.500 3.7e-03
astrocytoma 1.400 8.7e-12
Astrocytoma, Pilocytic 2.200 6.5e-09
Barrett's esophagus 1.200 2.1e-02
chronic kidney disease 1.500 1.4e-02
cutaneous lupus erythematosus 2.100 8.0e-04
dermatomyositis 2.500 4.6e-03
ependymoma 1.700 1.9e-07
esophageal adenocarcinoma 2.100 1.8e-02
glioblastoma 1.800 9.4e-06
interstitial cystitis 2.000 2.0e-03
juvenile dermatomyositis 2.763 5.1e-14
lung cancer -3.300 1.3e-05
lung carcinoma -2.000 9.9e-16
medulloblastoma, large-cell -1.500 2.0e-03
Multiple myeloma 1.288 6.3e-04
oligodendroglioma 1.100 8.2e-09
ovarian cancer -2.100 4.4e-03
pancreatic cancer 1.200 2.8e-03
primary pancreatic ductal adenocarcinoma 1.116 4.0e-03
primary Sjogren syndrome 2.300 8.0e-04
psoriasis 2.600 2.1e-04
subependymal giant cell astrocytoma 1.868 1.4e-02
tuberculosis 1.400 4.4e-05

Gene RIF (87)

AA Sequence

MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAA      1 - 70
DAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLT     71 - 140
RQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILG    141 - 210
NELPKFYDE                                                                 211 - 219
//

Text Mined References (96)

PMID Year Title