Property Summary

NCBI Gene PubMed Count 82
PubMed Score 373.96
PubTator Score 284.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 9.93353030943484E-16
juvenile dermatomyositis 1189 5.10140006980679E-14
astrocytoma 1493 8.66602803242824E-12
posterior fossa group A ependymoma 1511 1.02049089869455E-9
pilocytic astrocytoma 3086 7.65932182634641E-9
oligodendroglioma 2849 8.22488143954835E-9
ulcerative colitis 2087 1.75075394230151E-8
lung cancer 4473 1.32356182475562E-5
tuberculosis 1563 4.4271615967536E-5
glioblastoma 5572 9.11169191596158E-5
psoriasis 6685 2.12107163413671E-4
pediatric high grade glioma 2712 4.28145052698713E-4
active Crohn's disease 918 4.65770408735664E-4
Multiple myeloma 1328 6.31529561339989E-4
cutaneous lupus erythematosus 1056 7.97388514902143E-4
primary Sjogren syndrome 789 8.03511863858698E-4
ovarian cancer 8492 9.17631780670251E-4
medulloblastoma, large-cell 6234 0.00195693242260232
interstitial cystitis 2299 0.00203438396329359
pancreatic cancer 2300 0.00282648812244345
primary pancreatic ductal adenocarcinoma 1271 0.00400401881577402
dermatomyositis 967 0.00464260846258138
chronic kidney disease 90 0.0141880195005187
subependymal giant cell astrocytoma 2287 0.0143208939971197
esophageal adenocarcinoma 737 0.0176010007179145
Barrett's esophagus 185 0.0212957615518905

Expression

  Differential Expression (26)

Disease log2 FC p
Multiple myeloma 1.288 0.001
Barrett's esophagus 1.200 0.021
esophageal adenocarcinoma 2.100 0.018
cutaneous lupus erythematosus 2.100 0.001
psoriasis 2.600 0.000
astrocytoma 1.400 0.000
glioblastoma 2.500 0.000
oligodendroglioma 1.100 0.000
posterior fossa group A ependymoma 2.200 0.000
medulloblastoma, large-cell -1.500 0.002
juvenile dermatomyositis 2.763 0.000
chronic kidney disease 1.500 0.014
tuberculosis 1.400 0.000
primary pancreatic ductal adenocarcinoma 1.116 0.004
lung cancer -3.300 0.000
active Crohn's disease 2.767 0.000
ulcerative colitis 2.200 0.000
pancreatic cancer 1.200 0.003
interstitial cystitis 2.000 0.002
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 2.100 0.000
primary Sjogren syndrome 2.300 0.001
subependymal giant cell astrocytoma 1.868 0.014
lung carcinoma -2.000 0.000
ovarian cancer 2.200 0.001
dermatomyositis 2.500 0.005

Synonym

Accession P28065 B0V0T1 Q16523 Q5JNW4
Symbols LMP2
PSMB6i
RING12
beta1i

Gene

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (83)

PMID Text
25548428 The TAP1-rs1135216 and PSMB9-rs17587 variants are significantly associated with vitiligo, and even one copy of these mutant alleles can influence the risk among Saudis.
25098831 Comparison with reference profiles of sorted immune cells and healthy muscle confirmed upregulation of PSMB8 and -9 in myositis biopsies beyond infiltration related changes.
24809174 The data show that LMP2 and PSMA6 gene polymorphism is not a risk factor of ischemic stroke in Ukrainian population.
24377540 study found prevalence of LMP2-AA genotype was higher in acute myeolid leukemia (AML) patients while it was significantly lower in multiple myeloma (MM) cases than in the control subjects; results suggestLMP2 polymorphisms could play a role in the development of AML and MM
24040045 Data indicate that the codon 60 Arg/His polymorphism does not significantly alter the expression and activity of beta1i among the cell lines tested and clinical samples from colon and pancreatic cancer.
23568741 Genetic polymorphisms of rs17587 of PSMB9 appeared to be associated with rheumatoid arthritis in ethnic Han Chinese from Yunnan.
23360169 functional variants in PSMB9 may contribute to melanoma susceptibility.
23018640 Data indicate that treatment-emergent resistance to single-agent bortezomib was independent of variants in the proteasome genes PSMB1, PSMB5, PSMB6, PSMB8, PSMB9, and PSMB10.
22944692 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) subunit, beta type, 9 (PSMB9) at amino acid residues 25-26 by the HIV-1 protease
22925930 The MAGE-C(2336-344) antigenic peptide is produced by the immunoproteasome and intermediate proteasome beta1i-beta5i, but not by the standard proteasome nor intermediate proteasome beta5i.
More...

AA Sequence

MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAA      1 - 70
DAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLT     71 - 140
RQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILG    141 - 210
NELPKFYDE                                                                 211 - 219
//

Text Mined References (92)

PMID Year Title
26524591 2015 Additive loss-of-function proteasome subunit mutations in CANDLE/PRAAS patients promote type I IFN production.
25548428 2014 Transporter TAP1-637G and immunoproteasome PSMB9-60H variants influence the risk of developing vitiligo in the Saudi population.
25098831 2014 Upregulation of immunoproteasome subunits in myositis indicates active inflammation with involvement of antigen presenting cells, CD8 T-cells and IFN?.
24809174 2014 [Frequency of allele polymorphism of immune proteasome catalytic subunits in patients with ischemic stroke].
24377540 2013 Association of an LMP2 polymorphism with acute myeloid leukemia and multiple myeloma.
24040045 2013 PSMB9 codon 60 polymorphisms have no impact on the activity of the immunoproteasome catalytic subunit B1i expressed in multiple types of solid cancer.
23568741 2013 [Association between polymorphisms of PSMB8, PSMB9 and TAP2 genes with rheumatoid arthritis in ethnic Han Chinese from Yunnan].
23360169 2013 Association between putative functional variants in the PSMB9 gene and risk of melanoma--re-analysis of published melanoma genome-wide association studies.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23018640 2012 Sequence analysis of ?-subunit genes of the 20S proteasome in patients with relapsed multiple myeloma treated with bortezomib or dexamethasone.
More...