Property Summary

NCBI Gene PubMed Count 27
PubMed Score 29.51
PubTator Score 27.37

Knowledge Summary

Patent (3,005)

TINX Plot

  Disease (3)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 2.100 1.7e-02
atypical teratoid/rhabdoid tumor -1.500 7.6e-03
colon cancer -1.400 1.7e-03
Down syndrome 1.500 9.4e-04
ependymoma 1.700 3.6e-07
glioblastoma 1.100 1.1e-02
group 3 medulloblastoma -2.800 9.8e-05
lung cancer -2.200 1.0e-05
lung carcinoma -1.400 7.4e-23
malignant mesothelioma -1.900 7.2e-06
medulloblastoma, large-cell -2.500 1.3e-05
osteosarcoma 1.249 4.8e-03
Pick disease 1.200 7.3e-03
psoriasis -3.000 6.9e-05
tuberculosis -1.100 3.2e-04

Gene RIF (11)

AA Sequence

MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPPAESLSPEEPR      1 - 70
SPGGWRSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQRELQN     71 - 140
VQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSPCPFRSSSQPPGRVLVQGARSEERRTKSWGEQCP    141 - 210
ETSGTDSGRKGGPSLCSSQVKKGMPPLPGRAAPTGSEAQGPSAFVRMEKGIPASPRCGSPTAMEIDKRGS    211 - 280
PTPGTRSCLAPSLGLFGASLTMATEVAARVTSTGPHRPQDLALTEPSGRARELEDLQPPEALVERQGQFL    281 - 350
GSETSPAPERGGPRDGEPPGKMGKGYLPCGMPGSGEPEVGKRPEETTVSVQSAESSDSLSWSRLPRALAS    351 - 420
VGPEEARSGAPVGGGRWQLSDRVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKE    421 - 490
PQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSDALPSPELLPQDPDKPFLRKA    491 - 560
CSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPN    561 - 630
SAFLHTLDQQKPRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCL    631 - 700
DRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMY    701 - 770
QKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAF    771 - 840
REFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTL    841 - 910
QHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA                                      911 - 946
//

Text Mined References (31)

PMID Year Title