Property Summary

NCBI Gene PubMed Count 452
Grant Count 72
R01 Count 46
Funding $5,212,423.03
PubMed Score 301.34
PubTator Score 383.97

Knowledge Summary

Patent (46,106)

Expression

  Differential Expression (29)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.018
pancreatic cancer -1.800 0.000
oligodendroglioma 1.200 0.008
permanent atrial fibrillation -1.400 0.004
psoriasis -3.200 0.000
osteosarcoma 1.979 0.000
medulloblastoma -1.900 0.001
atypical teratoid / rhabdoid tumor -2.900 0.000
glioblastoma -1.100 0.012
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.200 0.006
juvenile dermatomyositis 1.056 0.000
tuberculosis -1.100 0.004
non-small cell lung cancer -1.189 0.000
lung cancer -2.800 0.000
Parkinson's disease -1.100 0.034
breast carcinoma -1.600 0.000
interstitial cystitis -1.100 0.001
cystic fibrosis -1.300 0.004
pancreatic carcinoma -1.800 0.000
lung adenocarcinoma -2.400 0.000
Breast cancer -1.900 0.000
Pick disease 1.100 0.001
ductal carcinoma in situ -1.500 0.001
invasive ductal carcinoma -2.300 0.000
ovarian cancer -2.900 0.000
Gaucher disease type 1 -1.400 0.018
pituitary cancer -1.300 0.009
dermatomyositis 1.100 0.011

Synonym

Gene

PANTHER Protein Class (2)

PDB

1A0N   1AZG   1H9O   1PBW   1PHT   1PIC   1PKS   1PKT   2IUG   2IUH   2IUI   2RD0   2V1Y   3HHM   3HIZ   3I5R   3I5S   4A55   4JPS   4L1B   4L23   4L2Y   4OVU   4OVV   4WAF   4YKN   4ZOP   5AUL   5FI4   5ITD  

Gene RIF (204)

PMID Text
26867574 RAC1/RAC2 and SFK are proximal and essential for phosphatidylinositol 3-kinase (PI3K) activation in NK cell-mediated direct cytotoxicity against Cryptococcus neoformans.
26827886 PI3KR1 plays a crucial role in the development of germinal center follicular helper T cells and is not involved in the generation of normal follicular regulatory T cells
26676464 PIK3R1 knockdown abrogated antimiR21-induced effect on breast cancer cells.
26565021 A Cytosolic Multiprotein Complex Containing p85alpha Is Required for beta-Catenin Activation in Colitis and Colitis-associated Cancer.
26475863 study provides new insight into the structure and assembly of the p85alpha homodimer and suggests that this protein is a highly dynamic molecule whose conformational flexibility allows it to transiently associate with multiple binding proteins.
26284543 NOS stimulation via PI3K, calpain proteases, and SIRT1-dependent deacetylation downstream from VEGFR2 activation contributes to these vasodilator responses.
26222500 As a consequence, homodimeric but not monomeric p85alpha suppresses the phosphatidylinositol 3-kinase pathway by protecting PTEN from E3 ligase WWP2-mediated proteasomal degradation.
26125867 Three of these, PIK3R1, VEGFA, and ITGB1, are known to be associated with preeclampsia or preeclampsia-related biological processes
26122737 Analysis of interdomain interactions of wild-type and mutants at the p110alpha-p85alpha interface with molecular dynamics simulations suggest that tumor-associated mutations weaken interactions between p110alpha and p85alpha by disrupting key stabilizing interactions.
25979433 The synaptic recruitment of lipid rafts is dependent on CD19-PI3K module and cytoskeleton remodeling molecules.
More...

AA Sequence

MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFP      1 - 70
GTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIE     71 - 140
KKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLA    141 - 210
PEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASS    211 - 280
DNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDT    281 - 350
ADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL    351 - 420
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNET    421 - 490
IKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREID    491 - 560
KRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN    561 - 630
RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQH    631 - 700
TSLVQHNDSLNVTLAYPVYAQQRR                                                  701 - 724
//

Text Mined References (476)

PMID Year Title
26867574 2016 Ras-related C3 Botulinum Toxin Substrate (Rac) and Src Family Kinases (SFK) Are Proximal and Essential for Phosphatidylinositol 3-Kinase (PI3K) Activation in Natural Killer (NK) Cell-mediated Direct Cytotoxicity against Cryptococcus neoformans.
26827886 2016 Reduced germinal center follicular helper T cells but normal follicular regulatory T cells in the tonsils of a patient with a mutation in the PI3KR1 gene.
26676464 2016 PIK3R1 targeting by miR-21 suppresses tumor cell migration and invasion by reducing PI3K/AKT signaling and reversing EMT, and predicts clinical outcome of breast cancer.
26565021 2016 A Cytosolic Multiprotein Complex Containing p85? Is Required for ?-Catenin Activation in Colitis and Colitis-associated Cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26475863 2015 Assembly and Molecular Architecture of the Phosphoinositide 3-Kinase p85? Homodimer.
26284543 2015 VEGF Receptor-2-Linked PI3K/Calpain/SIRT1 Activation Mediates Retinal Arteriolar Dilations to VEGF and Shear Stress.
26222500 2015 Regulation of the PI3K pathway through a p85? monomer-homodimer equilibrium.
26125867 2015 Partial least squares-based gene expression analysis in preeclampsia.
26122737 2015 Oncogenic mutations weaken the interactions that stabilize the p110?-p85? heterodimer in phosphatidylinositol 3-kinase ?.
More...