Property Summary

NCBI Gene PubMed Count 108
PubMed Score 78.02
PubTator Score 115.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease -1.249 3.5e-03
active ulcerative colitis -1.317 1.7e-02
adrenocortical adenoma -1.038 1.6e-02
colon cancer -1.500 4.0e-02
cutaneous lupus erythematosus -1.400 4.3e-02
cystic fibrosis 3.400 1.2e-03
glioblastoma 1.100 7.0e-03
interstitial cystitis 1.400 1.5e-02
intraductal papillary-mucinous adenoma (... 3.400 1.4e-03
intraductal papillary-mucinous carcinoma... 2.900 4.5e-03
intraductal papillary-mucinous neoplasm ... 4.600 2.4e-03
lung adenocarcinoma -2.200 6.1e-07
lung cancer -1.800 4.2e-04
lung carcinoma -1.100 2.9e-05
malignant mesothelioma -2.300 6.7e-06
nasopharyngeal carcinoma -1.400 3.3e-02
pancreatic cancer 2.000 1.9e-04
posterior fossa group A ependymoma 1.300 2.9e-03
Rheumatoid arthritis 2.500 4.0e-02
tuberculosis and treatment for 3 months -1.700 1.7e-02

 GWAS Trait (1)

Gene RIF (73)

AA Sequence

MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWH      1 - 70
KNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQ     71 - 140
ILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLT    141 - 210
FAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTH    211 - 280
IESAYPGGRVTEGPRQEYSENNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSW    281 - 350
GIVLAPLSLAFLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK                          351 - 398
//

Text Mined References (111)

PMID Year Title