Property Summary

NCBI Gene PubMed Count 99
Grant Count 19
R01 Count 13
Funding $1,690,191.9
PubMed Score 72.10
PubTator Score 115.24

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (65)

PMID Text
26324711 Interleukin-1alpha Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2
26209639 Data show that interleukin-1 receptor type 2 (IL1R2) forms a complex with c-Fos proto-oncogene protein and activates the interleukin-6 (IL-6) and vascular endothelial growth factor A (VEGF-A) promoters.
25849954 Suggest IL-1R2 as potential biomarker of acute respiratory distress syndrome.
25736356 This is the first detection that the genetic variation rs2302589 in IL-1R2 gene was associated with ankylosing spondylitis in Northern Han Chinese.
25650410 Cerebrospinal fluid soluble interleukin-1 Receptor II, but not log interleukin-6, levels were positively correlated with a composite measure of aggression.
25432697 results suggested that IL1R2 could have oncogenic potential in osteosarcoma
24818754 A genetic susceptibility locus for AgP may lie within or close to the IL1R2 locus in Japanese aggressive periodontitis.
24411993 First study evaluating for associations between cytokine gene variations and the development of persistent breast pain in women following breast cancer surgery: 1 SNP (IL1R2 rs11674595) and 1 haplotype (IL10 haplotype A8) were associated with pain
24313836 Data indicate a significant increase in the levels of IL-8, TNF-alpha and IL-1R2 in the CSF of both meningitis groups as compared to controls, and the concentrations of IFN-gamma and IL-1 differed significantly only between the mumps group and control.
23395675 Intracellular interleukin-1 receptor 2 binding prevents cleavage and activity of interleukin-1alpha, controlling necrosis-induced sterile inflammation.
More...

AA Sequence

MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWH      1 - 70
KNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQ     71 - 140
ILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLT    141 - 210
FAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTH    211 - 280
IESAYPGGRVTEGPRQEYSENNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSW    281 - 350
GIVLAPLSLAFLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK                          351 - 398
//

Text Mined References (102)

PMID Year Title
26324711 2015 Interleukin-1? Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2: IMPLICATIONS FOR ALLOGRAFT REJECTION.
26209639 2015 Interleukin-1 Receptor Type 2 Acts with c-Fos to Enhance the Expression of Interleukin-6 and Vascular Endothelial Growth Factor A in Colon Cancer Cells and Induce Angiogenesis.
25849954 2015 Microarray analysis identifies IL-1 receptor type 2 as a novel candidate biomarker in patients with acute respiratory distress syndrome.
25736356 2015 Association of IL-1R2 genetic polymorphisms with the susceptibility of ankylosing spondylitis in Northern Chinese Han population.
25650410 2015 Cerebrospinal fluid inflammatory cytokines and aggression in personality disordered subjects.
25432697 2015 Short hairpin RNA (shRNA) of type 2 interleukin-1 receptor (IL1R2) inhibits the proliferation of human osteosarcoma U-2 OS cells.
24818754 2014 Interleukin-1 receptor gene variants are associated with aggressive periodontitis in the Japanese.
24411993 2014 Associations between cytokine gene variations and severe persistent breast pain in women following breast cancer surgery.
24313836 2014 Increased levels of cytokines in cerebrospinal fluid of children with aseptic meningitis caused by mumps virus and echovirus 30.
24049095 2013 Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men.
More...