Property Summary

NCBI Gene PubMed Count 59
PubMed Score 1522.86
PubTator Score 431.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
chronic lymphosyte leukemia -1.300 3.8e-10
interstitial cystitis 1.400 2.9e-03
lung adenocarcinoma -2.100 5.1e-15
lung cancer -1.200 5.5e-04
mucosa-associated lymphoid tissue lympho... 1.864 2.6e-02
non-small cell lung cancer -1.317 5.4e-19
osteosarcoma -4.841 4.6e-07

Protein-protein Interaction (4)

Gene RIF (32)

AA Sequence

MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGG      1 - 70
LCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWS     71 - 140
GWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCH    141 - 210
GGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTME    211 - 280
QRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTC    281 - 350
RGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSM    351 - 420
VEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL                         421 - 469
//

Text Mined References (62)

PMID Year Title