Property Summary

NCBI Gene PubMed Count 55
Grant Count 57
R01 Count 22
Funding $13,703,875.99
PubMed Score 1491.51
PubTator Score 431.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -4.841 0.000
chronic lymphosyte leukemia -1.300 0.000
non-small cell lung cancer -1.317 0.000
lung cancer -1.200 0.001
interstitial cystitis 1.400 0.003
lung adenocarcinoma -2.100 0.000
mucosa-associated lymphoid tissue lympho... 1.864 0.026

Gene RIF (29)

PMID Text
26660535 P serum level expression could be a reliable clinical biomarker to identify patients with underlying surface alternative pathway C5 convertase dysregulation.
24885016 In the pathogenesis of renal tubular damage, P can directly bind to PTECs and may accelerate AP activation by surpassing fH regulation
24355864 can directly interact with neutrophil myeloperoxidase resulting in activation of alternative pathway of complement
23677468 Our data show that physiological forms of human properdin bind directly to human platelets after activation by strong agonists in the absence of C3
22851705 Properdin released from human polymorphonuclear cells does not bind to zymosan or E. coli, but when incubated in properdin-depleted serum this form of properdin binds efficiently to both substrates in a strictly complement C3-dependent manner.
22815489 Factor h and properdin recognize different epitopes on renal tubular epithelial heparan sulfate.
22368277 Immune human serum that contained bactericidal Abs directed against the 2C7 lipooligosaccharide epitope required functional properdin to kill C4BP-binding strains, but not C4BP-nonbinding strains.
22338105 Properdin and SC5b-9 may be novel biomarkers for future risk of type 2 diabetes in this high-risk population and warrant further investigation.
22229731 report a large Finnish family with a novel mutation in the properdin gene. The mutation is located in exon 9 and changes guanine to adenine at nucleotide 1164 (c.1164G>A) that causes tryptophan to change to a premature stop codon (W388X).
21135110 tubular HS as a novel docking platform for alternative pathway activation via properdin, which might play a role in proteinuric renal damage.
More...

AA Sequence

MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGG      1 - 70
LCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWS     71 - 140
GWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCH    141 - 210
GGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTME    211 - 280
QRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTC    281 - 350
RGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSM    351 - 420
VEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL                         421 - 469
//

Text Mined References (58)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26660535 2016 Serum properdin consumption as a biomarker of C5 convertase dysregulation in C3 glomerulopathy.
24885016 2014 Properdin has an ascendancy over factor H regulation in complement-mediated renal tubular damage.
24355864 2014 Myeloperoxidase directs properdin-mediated complement activation.
23677468 2013 Identification of a novel mode of complement activation on stimulated platelets mediated by properdin and C3(H2O).
22851705 2012 The role of properdin in zymosan- and Escherichia coli-induced complement activation.
22815489 2012 Factor h and properdin recognize different epitopes on renal tubular epithelial heparan sulfate.
22368277 2012 Properdin is critical for antibody-dependent bactericidal activity against Neisseria gonorrhoeae that recruit C4b-binding protein.
22338105 2012 Elevated properdin and enhanced complement activation in first-degree relatives of South Asian subjects with type 2 diabetes.
22229731 2012 A novel mutation W388X underlying properdin deficiency in a Finnish family.
More...