Property Summary

NCBI Gene PubMed Count 137
PubMed Score 714.95
PubTator Score 378.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia 1.300 4.9e-02
acute quadriplegic myopathy 1.038 2.0e-04
Astrocytoma, Pilocytic 1.100 4.5e-05
atypical teratoid / rhabdoid tumor 1.100 7.3e-04
diabetes mellitus -1.200 5.8e-03
Down syndrome 1.200 1.0e-03
Duchenne muscular dystrophy 1.066 8.6e-07
ependymoma 1.400 4.8e-02
glioblastoma 1.300 1.8e-02
group 4 medulloblastoma -1.400 1.1e-03
hereditary spastic paraplegia -1.136 9.1e-04
juvenile dermatomyositis 1.045 2.4e-10
lung adenocarcinoma 1.300 2.2e-08
lung carcinoma 1.400 5.3e-06
medulloblastoma, large-cell 1.600 2.9e-05
mucosa-associated lymphoid tissue lympho... -1.168 2.9e-02
Multiple myeloma 1.383 4.4e-04
non-small cell lung carcinoma 1.100 2.7e-11
oligodendroglioma 1.300 2.3e-02
osteosarcoma 1.572 1.2e-03
ovarian cancer -1.100 1.9e-03
pancreatic ductal adenocarcinoma liver m... -1.303 3.6e-02
subependymal giant cell astrocytoma 1.909 1.5e-02
Waldenstrons macroglobulinemia 1.034 9.1e-03

Protein-protein Interaction (3)

Gene RIF (62)

AA Sequence

MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY      1 - 70
FADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL     71 - 140
FDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK    141 - 210
TGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE    211 - 280
DRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW    281 - 350
EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS    351 - 420
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILT    421 - 490
VALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG    491 - 560
GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE                                          561 - 592
//

Text Mined References (152)

PMID Year Title