Property Summary

NCBI Gene PubMed Count 131
PubMed Score 679.13
PubTator Score 378.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 2.01170272760602E-20
lung adenocarcinoma 2714 4.62218895366807E-11
ovarian cancer 8492 7.38598585303516E-11
juvenile dermatomyositis 1189 7.59276103107312E-11
Duchenne muscular dystrophy 602 8.59113101189407E-7
acute quadriplegic myopathy 1157 9.93959276448943E-7
lung carcinoma 2844 5.29887198459694E-6
Multiple myeloma 1328 1.52278686631867E-5
medulloblastoma, large-cell 6234 2.91972380222434E-5
pilocytic astrocytoma 3086 3.53579817033518E-5
atypical teratoid / rhabdoid tumor 4369 7.28450309365459E-4
hereditary spastic paraplegia 313 9.07862676008915E-4
Down syndrome 548 0.00102472477619804
group 4 medulloblastoma 1875 0.00113955120090645
osteosarcoma 7933 0.00117220579550119
diabetes mellitus 1663 0.00220942025119625
oligodendroglioma 2849 0.00247046302746287
ependymoma 2514 0.00793504391036074
Waldenstrons macroglobulinemia 765 0.00905312210272515
subependymal giant cell astrocytoma 2287 0.0145606368713802
glioblastoma 5572 0.0180104440555121
mucosa-associated lymphoid tissue lymphoma 480 0.0289967516689228
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0355799936679889
acute myeloid leukemia 785 0.0489122360251439

Expression

Synonym

Accession P27824 B2R5V8 B4DGP8 B4E2T8 D3DWQ3 D6R9K3
Symbols CNX
P90
IP90

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (57)

PMID Text
26900856 To study principles underlying dynamics and regulation of palmitoylation, the ER chaperone calnexin, which requires dual palmitoylation for function, was investigated.
26861875 Endogenous NOX4 forms macromolecular complexes with calnexin, which are needed for the proper maturation, processing, and function of NOX4 in the endoplasmic reticulum.
26603938 These observations point at a previously unrecognized contribution of calnexin to the retention of NMT1 at the ER membrane.
25586181 Data indicate that protein tyrosine phosphatase 1B (PTP1B) association with calnexin is ubiquitin conjugating enzyme 9 (UBC9)-dependent.
25385046 Charcot-Marie-Tooth disease-related PMP22 is trapped in the endoplasmic reticulum by calnexin-dependent retention and Rer1-mediated early Golgi retrieval systems and partly degraded by the Hrd1-mediated endoplasmic reticulum-associated degradation system.
25170080 Nef regulates the activity of calnexin to stimulate its interaction with gp160 at the expense of ABCA1
25170080 Knockdown of calnexin by siRNA mimics the effects of HIV-1 Nef on ABCA1 downregulation in cells
24680774 The impact of CANX genetic variants to heart rate was discovered.
24386440 H-ERG trafficking was impaired by H2O2 after 48 h treatment, accompanied by reciprocal changes of expression between miR-17-5p seed miRNAs and several chaperones (Hsp70, Hsc70, CANX, and Golga20)
24056258 Soluble calnexin may fulfill functions similar to calreticulin.
More...

AA Sequence

MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY      1 - 70
FADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL     71 - 140
FDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK    141 - 210
TGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE    211 - 280
DRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW    281 - 350
EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS    351 - 420
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILT    421 - 490
VALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG    491 - 560
GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE                                          561 - 592
//

Text Mined References (147)

PMID Year Title
26900856 2016 Model-Driven Understanding of Palmitoylation Dynamics: Regulated Acylation of the Endoplasmic Reticulum Chaperone Calnexin.
26861875 2016 The Endoplasmic Reticulum Chaperone Calnexin Is a NADPH Oxidase NOX4 Interacting Protein.
26603938 2015 N-Myristoyltransferase 1 interacts with calnexin at the endoplasmic reticulum.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25586181 2015 UBC9-dependent association between calnexin and protein tyrosine phosphatase 1B (PTP1B) at the endoplasmic reticulum.
25385046 2014 Rer1 and calnexin regulate endoplasmic reticulum retention of a peripheral myelin protein 22 mutant that causes type 1A Charcot-Marie-Tooth disease.
25170080 2014 HIV-1 protein Nef inhibits activity of ATP-binding cassette transporter A1 by targeting endoplasmic reticulum chaperone calnexin.
24764305 2014 TMTC1 and TMTC2 are novel endoplasmic reticulum tetratricopeptide repeat-containing adapter proteins involved in calcium homeostasis.
24680774 2014 Insight into genetic determinants of resting heart rate.
24386440 2013 MiR-17-5p impairs trafficking of H-ERG K+ channel protein by targeting multiple er stress-related chaperones during chronic oxidative stress.
More...