Property Summary

NCBI Gene PubMed Count 54
PubMed Score 185.84
PubTator Score 114.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -4.900 2.3e-07
astrocytic glioma -3.000 2.0e-03
Astrocytoma, Pilocytic -5.600 1.4e-14
atypical teratoid / rhabdoid tumor -5.600 7.7e-07
autosomal dominant Emery-Dreifuss muscul... -1.463 3.2e-02
Becker muscular dystrophy -1.425 3.6e-02
Duchenne muscular dystrophy -1.233 3.6e-03
ependymoma -5.100 2.6e-03
gastric carcinoma 1.200 3.4e-03
glioblastoma -4.500 1.8e-10
group 3 medulloblastoma -2.800 3.8e-03
invasive ductal carcinoma -1.500 1.6e-03
limb girdle muscular dystrophy 2A -1.086 2.0e-02
medulloblastoma, large-cell -1.100 2.6e-04
Multiple myeloma 1.164 2.1e-03
oligodendroglioma -2.700 2.7e-02
osteosarcoma -1.281 1.7e-02
ovarian cancer -1.900 1.2e-05
psoriasis -2.700 3.4e-03
tuberculosis 1.500 2.8e-09

Gene RIF (26)

AA Sequence

MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSET      1 - 70
SQIEDTPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQTDP     71 - 140
FKMYHDDDLADLVFPSSATADTSIFAGQNDPLKDSYGMSPCNTAVVPQGWSVEALNSPHSESFVSPEAVA    141 - 210
EPPQPTAVPLELAKEIEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMES    211 - 280
PTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTL    281 - 350
LKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQ    351 - 420
ANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAK    421 - 490
DVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAK    491 - 560
DGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTG    561 - 630
TGKKCSLPAEEDSVLEKLGERKPCNSQPSELSSETSGIARPEEGRPVVSGTGNDITTPPNKELPPSPEKK    631 - 700
TKPLATTQPAKTSTSKAKTQPTSLPKQPAPTTIGGLNKKPMSLASGLVPAAPPKRPAVASARPSILPSKD    701 - 770
VKPKPIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTE    771 - 840
GKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTS    841 - 910
AKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGP    911 - 980
IASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPG    981 - 1050
GGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPT   1051 - 1120
SASGLNGHPTLSGGGDQREAQTLDSQIQETSI                                         1121 - 1152
//

Text Mined References (73)

PMID Year Title