Property Summary

NCBI Gene PubMed Count 52
Grant Count 53
R01 Count 37
Funding $15,992,372.62
PubMed Score 182.80
PubTator Score 114.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Multiple myeloma 1.164 0.002
astrocytoma -3.300 0.000
ependymoma -6.300 0.000
oligodendroglioma -3.400 0.000
psoriasis -2.700 0.003
glioblastoma -4.800 0.000
osteosarcoma -1.499 0.012
group 3 medulloblastoma -2.800 0.004
atypical teratoid / rhabdoid tumor -5.600 0.000
medulloblastoma, large-cell -3.100 0.000
Duchenne muscular dystrophy -1.233 0.004
limb girdle muscular dystrophy 2I -1.327 0.018
autosomal dominant Emery-Dreifuss muscul... -1.463 0.032
Becker muscular dystrophy -1.425 0.036
tuberculosis 1.500 0.000
adult high grade glioma -4.900 0.000
pilocytic astrocytoma -5.600 0.000
gastric carcinoma 1.200 0.003
invasive ductal carcinoma -1.500 0.002
ovarian cancer -1.900 0.000

Gene RIF (24)

PMID Text
26866982 Results show that marker rs218966 in gene PHF14 and rs9836027 in MAP4 significantly associated with hypertension; additionally, rare variants in SNUPN significantly associated with systolic blood pressure.
25746230 We demonstrated that the MAP4 (Ser696 and Ser787) phosphorylation increased concomitantly with the p38/MAPK pathway activation by the LPS and TNF-alpha stimulation of HPMECs, which induced MT disassembly followed by hyperpermeability.
25631074 Cellular biotinylated microtubule-associated protein 4 (MAP4) is incorporated into HIV-1 Gag virus-like particles
25323976 Results demonstrated that MAP4 mutations contribute to the clinical spectrum of centrosomal defects and confirmed the complex role of a centrosomal protein in centrosomal, ciliary, and Golgi regulation associated with severe short stature.
25010285 Cellular biotinylated microtubule-associated protein 4 (MAP4) is incorporated into HIV-1 Gag virus-like particles
24140250 Data show that cAMP/alpha isoform of the catalytic subunit of human PKA (PKAc-alpha) signaling can disrupt microtubule (MT) cytoskeleton by the phosphorylation of microtubule-Associated Protein 4 (MAP4).
23572511 MAP4, which is a binding partner of SEPT2.
22164227 there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization
22018492 DNAL1 and MAP4 may exert their functions in the HIV life cycle at reverse transcription, prior to nuclear translocation.
22018492 Knockdown of microtubule-associated protein 4 (MAP4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
More...

AA Sequence

MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSET      1 - 70
SQIEDTPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQTDP     71 - 140
FKMYHDDDLADLVFPSSATADTSIFAGQNDPLKDSYGMSPCNTAVVPQGWSVEALNSPHSESFVSPEAVA    141 - 210
EPPQPTAVPLELAKEIEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMES    211 - 280
PTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTL    281 - 350
LKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQ    351 - 420
ANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAK    421 - 490
DVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAK    491 - 560
DGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTG    561 - 630
TGKKCSLPAEEDSVLEKLGERKPCNSQPSELSSETSGIARPEEGRPVVSGTGNDITTPPNKELPPSPEKK    631 - 700
TKPLATTQPAKTSTSKAKTQPTSLPKQPAPTTIGGLNKKPMSLASGLVPAAPPKRPAVASARPSILPSKD    701 - 770
VKPKPIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTE    771 - 840
GKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTS    841 - 910
AKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGP    911 - 980
IASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPG    981 - 1050
GGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPT   1051 - 1120
SASGLNGHPTLSGGGDQREAQTLDSQIQETSI                                         1121 - 1152
//

Text Mined References (70)

PMID Year Title
26866982 2016 Filtering genetic variants and placing informative priors based on putative biological function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25746230 2015 P38/MAPK contributes to endothelial barrier dysfunction via MAP4 phosphorylation-dependent microtubule disassembly in inflammation-induced acute lung injury.
25323976 2015 MAP4-dependent regulation of microtubule formation affects centrosome, cilia, and Golgi architecture as a central mechanism in growth regulation.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140250 2014 Activation of cyclic AMP/PKA pathway inhibits bladder cancer cell invasion by targeting MAP4-dependent microtubule dynamics.
23572511 2013 Septins 2, 7 and 9 and MAP4 colocalize along the axoneme in the primary cilium and control ciliary length.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...