Property Summary

NCBI Gene PubMed Count 52
PubMed Score 182.80
PubTator Score 114.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ependymoma 2514 2.08330818707352E-27
astrocytoma 1493 7.30148896007342E-18
oligodendroglioma 2849 7.50475644743112E-15
pilocytic astrocytoma 3086 5.41215036257673E-14
tuberculosis 1563 2.80795361840702E-9
adult high grade glioma 2148 2.25571252427803E-7
atypical teratoid / rhabdoid tumor 4369 7.66810393883823E-7
ovarian cancer 8492 1.18644211002009E-5
glioblastoma 5572 2.12691358683171E-5
medulloblastoma, large-cell 6234 2.95130922343939E-4
invasive ductal carcinoma 2950 0.00157619879478988
Multiple myeloma 1328 0.00208021399868421
psoriasis 6685 0.00341468320758867
gastric carcinoma 832 0.00344962250181341
Duchenne muscular dystrophy 602 0.00364546837119617
group 3 medulloblastoma 2254 0.00381402412084461
osteosarcoma 7933 0.0119358981457284
limb girdle muscular dystrophy 2I 56 0.0184572152633575
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0323236059045802
Becker muscular dystrophy 187 0.0360019373039037
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0

Expression

  Differential Expression (20)

Disease log2 FC p
Multiple myeloma 1.164 0.002
astrocytoma -3.300 0.000
ependymoma -6.300 0.000
oligodendroglioma -3.400 0.000
psoriasis -2.700 0.003
glioblastoma -4.800 0.000
osteosarcoma -1.499 0.012
group 3 medulloblastoma -2.800 0.004
atypical teratoid / rhabdoid tumor -5.600 0.000
medulloblastoma, large-cell -3.100 0.000
Duchenne muscular dystrophy -1.233 0.004
limb girdle muscular dystrophy 2I -1.327 0.018
autosomal dominant Emery-Dreifuss muscul... -1.463 0.032
Becker muscular dystrophy -1.425 0.036
tuberculosis 1.500 0.000
adult high grade glioma -4.900 0.000
pilocytic astrocytoma -5.600 0.000
gastric carcinoma 1.200 0.003
invasive ductal carcinoma -1.500 0.002
ovarian cancer -1.900 0.000

Gene

  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow EggNOG Inparanoid
Opossum EggNOG Inparanoid

 MGI Term (1)

 GWAS Trait (1)

Gene RIF (24)

PMID Text
26866982 Results show that marker rs218966 in gene PHF14 and rs9836027 in MAP4 significantly associated with hypertension; additionally, rare variants in SNUPN significantly associated with systolic blood pressure.
25746230 We demonstrated that the MAP4 (Ser696 and Ser787) phosphorylation increased concomitantly with the p38/MAPK pathway activation by the LPS and TNF-alpha stimulation of HPMECs, which induced MT disassembly followed by hyperpermeability.
25631074 Cellular biotinylated microtubule-associated protein 4 (MAP4) is incorporated into HIV-1 Gag virus-like particles
25323976 Results demonstrated that MAP4 mutations contribute to the clinical spectrum of centrosomal defects and confirmed the complex role of a centrosomal protein in centrosomal, ciliary, and Golgi regulation associated with severe short stature.
25010285 Cellular biotinylated microtubule-associated protein 4 (MAP4) is incorporated into HIV-1 Gag virus-like particles
24140250 Data show that cAMP/alpha isoform of the catalytic subunit of human PKA (PKAc-alpha) signaling can disrupt microtubule (MT) cytoskeleton by the phosphorylation of microtubule-Associated Protein 4 (MAP4).
23572511 MAP4, which is a binding partner of SEPT2.
22164227 there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization
22018492 DNAL1 and MAP4 may exert their functions in the HIV life cycle at reverse transcription, prior to nuclear translocation.
22018492 Knockdown of microtubule-associated protein 4 (MAP4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
More...

AA Sequence

MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSET      1 - 70
SQIEDTPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQTDP     71 - 140
FKMYHDDDLADLVFPSSATADTSIFAGQNDPLKDSYGMSPCNTAVVPQGWSVEALNSPHSESFVSPEAVA    141 - 210
EPPQPTAVPLELAKEIEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMES    211 - 280
PTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTL    281 - 350
LKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQ    351 - 420
ANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAK    421 - 490
DVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAK    491 - 560
DGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTG    561 - 630
TGKKCSLPAEEDSVLEKLGERKPCNSQPSELSSETSGIARPEEGRPVVSGTGNDITTPPNKELPPSPEKK    631 - 700
TKPLATTQPAKTSTSKAKTQPTSLPKQPAPTTIGGLNKKPMSLASGLVPAAPPKRPAVASARPSILPSKD    701 - 770
VKPKPIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTE    771 - 840
GKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTS    841 - 910
AKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGP    911 - 980
IASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPG    981 - 1050
GGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPT   1051 - 1120
SASGLNGHPTLSGGGDQREAQTLDSQIQETSI                                         1121 - 1152
//

Text Mined References (70)

PMID Year Title
26866982 2016 Filtering genetic variants and placing informative priors based on putative biological function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25746230 2015 P38/MAPK contributes to endothelial barrier dysfunction via MAP4 phosphorylation-dependent microtubule disassembly in inflammation-induced acute lung injury.
25323976 2015 MAP4-dependent regulation of microtubule formation affects centrosome, cilia, and Golgi architecture as a central mechanism in growth regulation.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140250 2014 Activation of cyclic AMP/PKA pathway inhibits bladder cancer cell invasion by targeting MAP4-dependent microtubule dynamics.
23572511 2013 Septins 2, 7 and 9 and MAP4 colocalize along the axoneme in the primary cilium and control ciliary length.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...