Property Summary

NCBI Gene PubMed Count 54
Grant Count 288
R01 Count 154
Funding $29,896,974.84
PubMed Score 1167.78
PubTator Score 691.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
astrocytic glioma -1.100 0.002
psoriasis -1.700 0.000
glioblastoma -1.600 0.005
osteosarcoma -1.020 0.020
ependymoma -1.400 0.000
group 3 medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -2.100 0.000
adrenocortical carcinoma -1.128 0.004
tuberculosis -1.200 0.000
fibroadenoma -1.100 0.040
adult high grade glioma -1.600 0.000
invasive ductal carcinoma -1.100 0.031
ovarian cancer 1.300 0.002

Synonym

Accession P27815 O75522 O76092 Q16255 Q16691 Q5DM53 Q6PMT2 Q8IVA7 Q8WUQ3 Q9H3H2
Symbols PDE4
DPDE2
PDE46

Gene

PANTHER Protein Class (2)

PDB

2QYK   3I8V   3TVX  

 GWAS Trait (1)

Gene RIF (41)

PMID Text
25576684 After 48 h yessotoxin treatment PDE4A-dependent autophagy, as non-apoptotic programmed cell death, is activated.
25230992 curcumin exerts its in vitro anti-angiogenic and in vivo anti-tumour properties through combined PDE2 and PDE4 inhibition
24813785 AKAP 149-PKA-PDE4A complex localization is related with YTX effect in K-562 cell line
24732776 Cyclic AMP phosphodiesterase inhibitors AV411 and AV1013 inhibit HIV-1 replication and block HIV-1 Tat-induced neurotoxicity in human microglia, suggesting that cyclic AMP phosphodiesterase is involved in the Tat-mediated neurotoxicity
24616094 Hydroxycarbamide decreases sickle reticulocyte adhesion to resting endothelium by inhibiting endothelial lutheran/basal cell adhesion molecule (Lu/BCAM) through phosphodiesterase 4A activation.
24227907 long-acting beta -agonist and PDE4 inhibitor have a synergistic effect in regulating fibroblast tissue repair functions and PGE2 can modulate the effect of beta -agonist and PDE4 inhibitor at least in part through the mechanism of regulating PDE4 expression
23043089 PDE4A and PDE4C work in redundant fashion to mediate the loss of inhibitory PGE2 signaling in lung fibroblasts.
23008439 In phosphoinositide 3-kinasegamma-deficient cardiomyocytes, coincident signaling of the major cardiac PDE3 and PDE4 isoforms orchestrates a feedback loop that prevents calcium-dependent ventricular arrhythmia.
22484154 The hPDE4 long isoforms are activated by phosphorylation of a serine located in a conserved RRESF motif in a tandem of N-terminal upstream-conserved regions (UCR).
21898905 These results indicate that PDE4A and PLAT may be susceptibility genes for schizophrenia in the Japanese population.
More...

AA Sequence

MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQPHRPIERADA      1 - 70
MDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGRSPLDSQASPGLVLHAGAATS     71 - 140
QRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTPFAQVLASLRSVRSNFSLLTNVPVPSNKRSP    141 - 210
LGGPTPVCKATLSEETCQQLARETLEELDWCLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSG    211 - 280
NQVSEYISTTFLDKQNEVEIPSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNS    281 - 350
NIPRFGVKTDQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML    351 - 420
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNS    421 - 490
ELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMV    491 - 560
ETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPM    561 - 630
CDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGH    631 - 700
PPLPDKFQFELTLEEEEEEEISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASL    701 - 770
EAELEAVYLTQQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP    771 - 840
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT                            841 - 886
//

Text Mined References (60)

PMID Year Title
25576684 2015 Key role of phosphodiesterase 4A (PDE4A) in autophagy triggered by yessotoxin.
25230992 2015 Tumour growth inhibition and anti-angiogenic effects using curcumin correspond to combined PDE2 and PDE4 inhibition.
24813785 2014 Role of AKAP 149-PKA-PDE4A complex in cell survival and cell differentiation processes.
24616094 2014 Hydroxycarbamide decreases sickle reticulocyte adhesion to resting endothelium by inhibiting endothelial lutheran/basal cell adhesion molecule (Lu/BCAM) through phosphodiesterase 4A activation.
24227907 2013 PGE 2 desensitizes ? -agonist effect on human lung fibroblast-mediated collagen gel contraction through upregulating PDE4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043089 2012 Attenuation of inhibitory prostaglandin E2 signaling in human lung fibroblasts is mediated by phosphodiesterase 4.
23008439 2012 Phosphoinositide 3-kinase ? protects against catecholamine-induced ventricular arrhythmia through protein kinase A-mediated regulation of distinct phosphodiesterases.
22484154 2012 The regulatory tandem domains of human phosphodiesterases 1 and 4 regulate a cyanobacterial adenylyl cyclase.
21898905 2011 Positive association of phencyclidine-responsive genes, PDE4A and PLAT, with schizophrenia.
More...