Property Summary

NCBI Gene PubMed Count 322
Grant Count 431
R01 Count 267
Funding $49,845,875.46
PubMed Score 1423.93
PubTator Score 894.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P27797 Q6IAT4 Q9UDG2
Symbols RO
CRT
SSA
cC1qR
HEL-S-99n

Gene

PANTHER Protein Class (1)

PDB

2CLR   3DOW   3POS   3POW   5LK5  

Gene RIF (231)

PMID Text
26890983 Even after CALR mutation variant stratification, driver mutational status did not impact overall, myelofibrosis-free, thrombosis-free, and leukemia-free survival in essential thrombocythemia.
26825145 Letter: CALR mutations are rare in Chinese Budd-Chiari syndrome patients.
26817954 mutant CALR promotes myeloproliferative neoplasm development by activating c-MPL and its downstream pathway.
26777583 CALR mutated clones are present in bone marrow cells of essential thrombocythemia and primary myelofibrosis patients.
26668133 Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants.
26646311 The combination of a decreased expression of HMGB1, an increased expression of extracellular HSP70, and an increased expression of CRT in the relapse seems to be beneficial for patient survival.
26640226 Studied calreticulin mRNA expression levels in acute myeloid leukemia (AML) compared with other hematologic malignancies, and to investigate the clinicopathological characteristics associated with expression in AML patients.
26614694 findings suggest that JAK2V617F-positive ET patients and CALR mutation-positive patients have different mechanisms of occurrence and clinical features of ET
26573090 Mutant calreticulin-expressing cells induce monocyte hyperreactivity through a paracrine mechanism.
26481236 propose that there is a link between binding of BEND3 to the CALR rs138452745 C-allele and removal of NFI binding site from this nucleotide, and the evolution of human-specific higher brain functions
More...

AA Sequence

MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQ      1 - 70
DARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPG     71 - 140
TKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKD    141 - 210
PDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQI    211 - 280
DNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT    281 - 350
KAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL       351 - 417
//

Text Mined References (330)

PMID Year Title
26890983 2016 Calreticulin variant stratified driver mutational status and prognosis in essential thrombocythemia.
26825145 2016 CALR mutations in Chinese Budd-Chiari syndrome patients.
26817954 2016 Activation of the thrombopoietin receptor by mutant calreticulin in CALR-mutant myeloproliferative neoplasms.
26777583 2016 Capricious CALR mutated clones in myeloproliferative neoplasms.
26668133 2016 Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants.
26646311 2016 Primary glioblastoma multiforme tumors and recurrence : Comparative analysis of the danger signals HMGB1, HSP70, and calreticulin.
26640226 2015 Calreticulin mRNA expression and clinicopathological characteristics in acute myeloid leukemia.
26614694 2016 Clinical features of Japanese polycythemia vera and essential thrombocythemia patients harboring CALR, JAK2V617F, JAK2Ex12del, and MPLW515L/K mutations.
26573090 2016 Mutant calreticulin-expressing cells induce monocyte hyperreactivity through a paracrine mechanism.
26481236 2016 BEND3 is involved in the human-specific repression of calreticulin: Implication for the evolution of higher brain functions in human.
More...