Property Summary

NCBI Gene PubMed Count 374
PubMed Score 1544.18
PubTator Score 894.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Chromosome 19p13.13 deletion syndrome 5 0.0 5.0

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.015 1.6e-02
adult high grade glioma 1.700 6.5e-04
astrocytoma 1.500 8.9e-04
Astrocytoma, Pilocytic 2.000 4.5e-05
atypical teratoid / rhabdoid tumor 2.700 1.4e-07
autosomal dominant Emery-Dreifuss muscul... 1.717 4.0e-03
Becker muscular dystrophy 1.132 3.9e-02
Breast cancer 1.300 2.7e-05
breast carcinoma 1.200 2.0e-10
Duchenne muscular dystrophy 1.578 8.6e-06
ependymoma 1.800 2.6e-06
glioblastoma 1.400 4.3e-04
group 4 medulloblastoma 2.400 1.4e-05
juvenile dermatomyositis 2.037 6.0e-11
medulloblastoma, large-cell 2.500 1.9e-04
osteosarcoma 3.244 4.8e-07
ovarian cancer 1.100 3.6e-04
pancreatic ductal adenocarcinoma liver m... -2.052 2.6e-03
psoriasis -1.700 1.3e-04
ulcerative colitis 1.200 2.4e-04

Protein-protein Interaction (1)

Gene RIF (280)

AA Sequence

MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQ      1 - 70
DARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPG     71 - 140
TKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKD    141 - 210
PDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQI    211 - 280
DNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT    281 - 350
KAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL       351 - 417
//

Text Mined References (383)

PMID Year Title