Property Summary

NCBI Gene PubMed Count 35
Grant Count 86
R01 Count 31
Funding $26,464,120.82
PubMed Score 164.64
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.200 0.001
medulloblastoma 1.400 0.000
astrocytoma 1.200 0.001
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 2.200 0.000
primitive neuroectodermal tumor 1.400 0.000
non-small cell lung cancer 1.355 0.000
lung cancer 1.500 0.004
pediatric high grade glioma 1.100 0.000
ovarian cancer 1.100 0.000

Synonym

Accession P27708 D6W552 Q6P0Q0 Q96CK3
Symbols CDG1Z

Gene

CAD

PANTHER Protein Class (1)

PDB

4BY3   4C6B   4C6C   4C6D   4C6E   4C6F   4C6I   4C6J   4C6K   4C6L   4C6M   4C6N   4C6O   4C6P   4C6Q   5G1N   5G1O   5G1P  

Gene RIF (20)

PMID Text
26446564 Previous study found three metal ions in huDHOase active site; in the present study, the putative third metal binding site in type II enzymes, such as StDHOase and ScDHOase, was created and identified.
25678555 Changes in glycosylation in caused by mutations in CAD.
25422319 These results establish CAD as a downstream effector of Rheb and suggest a possible role of Rheb in regulating de novo pyrimidine nucleotide synthesis
24316846 Recombinant aspartate carbamoyltransferase domain from the CAD enzyme complex forms homotrimers in solution.
23594158 The results obtained indicate that mLST8 bridges between CAD and mTOR, and plays a role in the signaling mechanism where CAD is regulated in the mTOR pathway through the association with mLST8
23143245 preliminary X-ray diffraction analysis of the dihydroorotase domain of human CAD
23125841 Tandem affinity purification and mass spectrometry analysis identify carbamoyl-phosphate synthetase 2 (CAD), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify carbamoyl-phosphate synthetase 2 (CAD), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify carbamoyl-phosphate synthetase 2 (CAD), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify carbamoyl-phosphate synthetase 2 (CAD), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPPDEMDEF      1 - 70
GLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLGKLVQ     71 - 140
NGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILALDCGLKYNQIRCLCQRGAEVTVVPWDHALD    141 - 210
SQEYEGLFLSNGPGDPASYPSVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPC    211 - 280
LLVGSGRCFLTSQNHGFAVETDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLF    281 - 350
DIFLETVKEATAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI    351 - 420
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTK    421 - 490
AGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFAL    491 - 560
GGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGE    561 - 630
SIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGY    631 - 700
PLAYVAAKLALGIPLPELRNSVTGGTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGR    701 - 770
SFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRM    771 - 840
KRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEW    841 - 910
PAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVS    911 - 980
TDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFK    981 - 1050
FSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKE   1051 - 1120
HPVVISKFIQEAKEIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVG   1121 - 1190
QELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPVGLMTGSGVVG   1191 - 1260
VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYKNKSELLP   1261 - 1330
TVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILEQLAEKNFELVINLSMRGA   1331 - 1400
GGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQKLVRLPGLIDV   1401 - 1470
HVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSE   1471 - 1540
NAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSV   1541 - 1610
HICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVI   1611 - 1680
DCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYV   1681 - 1750
EVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQL   1751 - 1820
PPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASDPGLPAEEPKEKSSRKVAEPELMGTPDGTCY   1821 - 1890
PPPPVPRQASPQNLGTPGLLHPQTSPLLHSLVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDIL   1891 - 1960
KGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGA   1961 - 2030
VELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVS   2031 - 2100
LRYVAPPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEACFGQFILTPH   2101 - 2170
IMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF                  2171 - 2225
//

Text Mined References (54)

PMID Year Title
26657846 2016 Versatile function of the circadian protein CIPC as a regulator of Erk activation.
26446564 2015 Creation of a putative third metal binding site in type II dihydroorotases significantly enhances enzyme activity.
25678555 2015 Biallelic mutations in CAD, impair de novo pyrimidine biosynthesis and decrease glycosylation precursors.
25422319 2015 Rheb protein binds CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamoylase, and dihydroorotase) protein in a GTP- and effector domain-dependent manner and influences its cellular localization and carbamoyl-phosphate synthetase (CPSase) activity.
24332717 2014 Structure, functional characterization, and evolution of the dihydroorotase domain of human CAD.
24316846 2013 Expression, purification, crystallization and preliminary X-ray diffraction analysis of the aspartate transcarbamoylase domain of human CAD.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23594158 2013 Association of CAD, a multifunctional protein involved in pyrimidine synthesis, with mLST8, a component of the mTOR complexes.
23429704 2013 Quantitative phosphoproteomics reveal mTORC1 activates de novo pyrimidine synthesis.
23429703 2013 Stimulation of de novo pyrimidine synthesis by growth signaling through mTOR and S6K1.
More...