Property Summary

NCBI Gene PubMed Count 9
PubMed Score 60.22
PubTator Score 144.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 3.7e-08
psoriasis 6694 4.9e-04
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 0.7
Disease Target Count Z-score Confidence
Salmonellosis 42 3.031 1.5

 GO Component (1)

Gene RIF (10)

AA Sequence

MMLKSITESFATAIHGLKVGHLTDRVIQRSKRMILDTLGAGFLGTTTEVFHIASQYSKIYSSNISSTVWG      1 - 70
QPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALAEALPRSPKFSGLDLLLAFNVGIEV     71 - 140
QGRLLHFAKEANDMPKRFHPPSVVGTLGSAAAASKFLGLSSTKCREALAIAVSHAGAPMANAATQTKPLH    141 - 210
IGNAAKHGIEAAFLAMLGLQGNKQVLDLEAGFGAFYANYSPKVLPSIASYSWLLDQQDVAFKRFPAHLST    211 - 280
HWVADAAASVRKHLVAERALLPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVP    281 - 350
SFHECQINRPQVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEE    351 - 420
KFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNLS             421 - 481
//

Text Mined References (10)

PMID Year Title