Property Summary

Ligand Count 52
NCBI Gene PubMed Count 85
PubMed Score 455.39
PubTator Score 338.66

Knowledge Summary

Patent (21,949)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 1.200 5.3e-06
gastric carcinoma 1.100 3.0e-02
medulloblastoma, large-cell -1.100 2.3e-03
osteosarcoma -2.034 2.1e-05
pituitary cancer 1.300 3.6e-06
primary Sjogren syndrome 2.300 7.1e-05
psoriasis -1.400 1.8e-04
sarcoidosis 1.300 1.7e-02
Waldenstrons macroglobulinemia 1.344 7.9e-03

Synonym

Accession P27707 B2R8V6 Q5TZY7 Q6FI11 dCK
Symbols

Gene

DCK

PANTHER Protein Class (3)

PDB

1P5Z   1P60   1P61   1P62   2A2Z   2A30   2A7Q   2NO0   2NO1   2NO6   2NO7   2NO9   2NOA   2QRN   2QRO   2ZI3   2ZI4   2ZI5   2ZI6   2ZI7   2ZI9   2ZIA   3HP1   3IPX   3IPY   3KFX   3MJR   3QEJ   3QEN   3QEO   4JLJ   4JLK   4JLM   4JLN   4KCG   4L5B   4Q18   4Q19   4Q1A   4Q1B   4Q1C   4Q1D   4Q1E   4Q1F  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (70)

AA Sequence

MATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEE      1 - 70
LTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASN     71 - 140
LYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHY    141 - 210
KHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL                        211 - 260
//

Text Mined References (99)

PMID Year Title