Property Summary

NCBI Gene PubMed Count 83
Grant Count 82
R01 Count 41
Funding $13,668,398.01
PubMed Score 442.47
PubTator Score 338.66

Knowledge Summary

Patent (21,949)

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.344 0.008
psoriasis -1.400 0.000
osteosarcoma -2.034 0.000
medulloblastoma, large-cell -1.100 0.002
sarcoidosis 1.300 0.017
primary Sjogren syndrome 2.300 0.000
gastric carcinoma 1.100 0.030
Breast cancer 1.200 0.000
pituitary cancer 1.300 0.000

Synonym

Accession P27707 B2R8V6 Q5TZY7 Q6FI11 dCK
Symbols

Gene

DCK

PANTHER Protein Class (3)

PDB

1P5Z   1P60   1P61   1P62   2A2Z   2A30   2A7Q   2NO0   2NO1   2NO6   2NO7   2NO9   2NOA   2QRN   2QRO   2ZI3   2ZI4   2ZI5   2ZI6   2ZI7   2ZI9   2ZIA   3HP1   3IPX   3IPY   3KFX   3MJR   3QEJ   3QEN   3QEO   4JLJ   4JLK   4JLM   4JLN   4KCG   4L5B   4Q18   4Q19   4Q1A   4Q1B   4Q1C   4Q1D   4Q1E   4Q1F  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (68)

PMID Text
26962792 expression and A9846G AA genotype significantly associated with reduced mortality in pancreatic ductal adenocarcinoma
26485161 recently described a human deoxycytidine kinase mutant (G12) that sensitizes cancer cell lines to treatment with gemcitabine. Here, starting from the G12 variant, we identified a mutant that triggers even greater sensitisation to gemcitabine than G12.
26196746 results strongly suggest that (1) the E197K alteration in DCK causes inactivation of DCK, and that (2) loss of the normal E197 allele is the crucial mechanism in acquisition of gemcitabine resistance in the RMKN28 tumor cell line
26090398 n the multivariate Cox regression analysis, we found that age at diagnosis, wild-type genotype of the CDA A79C polymorphism, and wild-type genotype of the dCK C360G polymorphism were the most significant prognostic factors for predicting the risk of death
26083014 RNA expression of deoxycytidine kinase (DCK), human equilibrative nucleoside transporter-1 (ENT1) and ribonucleotide reductase M1 (RRM1) were significantly higher and cytidine deaminase (CDA) was significantly lower in ex vivo Ara-C sensitive samples.
25557962 DCK rs12648166 and DCK rs4694362 SNPs were associated with hematologic toxicity (OR = 2.63, CI 95% = 1.37-5.04, P = 0.0036 and OR = 2.53, CI 95% = 1.34-4.80, P = 0.0044, respectively).
25533931 These findings indicate that the decitabine metabolic pathway affects its therapeutic effects, lower hENT1 expression may induce primary resistance and down-regulated DCK expression may be related to secondary resistance.
25358054 induction after hypoxia plays a role in the progression of pulmonary fibrosis by contributing to alveolar epithelial cell proliferation
24618665 DCK expression levels are prognostic and had predictive value for sensitivity to 5-FU in pancreatic cancer.
24462681 PP2A constitutively dephosphorylates dCK in cells and negatively regulates its activity.
More...

AA Sequence

MATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEE      1 - 70
LTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASN     71 - 140
LYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHY    141 - 210
KHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL                        211 - 260
//

Text Mined References (97)

PMID Year Title
26962792 2016 dCK Expression and Gene Polymorphism With Gemcitabine Chemosensitivity in Patients With Pancreatic Ductal Adenocarcinoma: A Strobe-Compliant Observational Study.
26485161 2015 Potent Sensitisation of Cancer Cells to Anticancer Drugs by a Quadruple Mutant of the Human Deoxycytidine Kinase.
26196746 2015 Acquisition of chemoresistance to gemcitabine is induced by a loss-of-function missense mutation of DCK.
26090398 2015 Role of Genetic Polymorphisms of Deoxycytidine Kinase and Cytidine Deaminase to Predict Risk of Death in Children with Acute Myeloid Leukemia.
26083014 2015 RNA expression of genes involved in cytarabine metabolism and transport predicts cytarabine response in acute myeloid leukemia.
25557962 2015 Impact of single nucleotide polymorphisms of cytarabine metabolic genes on drug toxicity in childhood acute lymphoblastic leukemia.
25533931 2015 The hENT1 and DCK genes underlie the decitabine response in patients with myelodysplastic syndrome.
25358054 2014 Hypoxia-induced deoxycytidine kinase contributes to epithelial proliferation in pulmonary fibrosis.
24618665 2014 dCK expression correlates with 5-fluorouracil efficacy and HuR cytoplasmic expression in pancreatic cancer: a dual-institutional follow-up with the RTOG 9704 trial.
24462681 2014 Protein phosphatase 2A regulates deoxycytidine kinase activity via Ser-74 dephosphorylation.
More...