Property Summary

NCBI Gene PubMed Count 162
PubMed Score 437.23
PubTator Score 448.48

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.020 2.9e-02
Astrocytoma, Pilocytic 1.200 1.9e-04
diabetes mellitus -1.200 3.8e-02
lung carcinoma -2.200 8.5e-31
malignant mesothelioma -3.600 8.9e-09
medulloblastoma, large-cell -1.200 7.9e-04
oligodendroglioma 1.100 3.7e-03
osteosarcoma -1.222 1.1e-03
ovarian cancer 1.100 2.8e-05
psoriasis 2.200 1.8e-05
tuberculosis -1.500 4.5e-09

Synonym

Accession P27701 D3DQN6 E9PC70 Q7Z2D4 Q7Z5N2
Symbols R2
4F9
C33
IA4
ST6
GR15
KAI1
SAR2
TSPAN27

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (151)

AA Sequence

MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMG      1 - 70
FLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAW     71 - 140
DYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWP    141 - 210
VYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY                 211 - 267
//

Text Mined References (166)

PMID Year Title