Property Summary

NCBI Gene PubMed Count 147
Grant Count 104
R01 Count 55
Funding $11,559,508.94
PubMed Score 421.88
PubTator Score 448.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -3.600 0.000
oligodendroglioma 1.100 0.004
psoriasis 2.200 0.000
osteosarcoma -1.222 0.001
medulloblastoma, large-cell -1.200 0.001
tuberculosis -1.600 0.000
active ulcerative colitis 1.020 0.029
diabetes mellitus -1.200 0.038
pilocytic astrocytoma 1.100 0.000
lung carcinoma -2.200 0.000
ovarian cancer 1.100 0.000

Synonym

Accession P27701 D3DQN6 E9PC70 Q7Z2D4 Q7Z5N2
Symbols R2
4F9
C33
IA4
ST6
GR15
KAI1
SAR2
TSPAN27

Gene

Gene RIF (138)

PMID Text
26681053 Survivin, Bcl-2, and KAI1 are metastasis-related factors in cervical cancer. Overexpression of survivin and Bcl-2, and low expression of KAI1 promotes cervical cancer progress and metastasis.
26408312 The expression of KAI1/CD82, CD44, MMP7 and beta-catenin is related to tumor metastasis and prognosis in colorectal carcinoma.
26335499 Ubiquitously expressed CD82 restrains cell migration and cell invasion by modulating both cell-matrix and cell-cell adhesiveness and confining outside-in pro-motility signaling.
26260387 CD82 regulated BCL2L12 expression via STAT5A and AKT signaling and stimulated proliferation and engrafting of leukemia cells.
26246476 Loss of both KAI1 and p27 defines a subgroup of primary melanoma patients with poor prognosis.
26231404 High KAI1 expression is associated with epithelial-mesenchymal transition in non-small cell lung cancer.
26199094 KAI1 was able to suppress melanoma angiogenesis by downregulating IL-6 and VEGF expression.
26132195 CD82 enhanced the expression of miR-203 and directly downregulated FZD2 expression, suppressing cancer metastasis/cell migration by inhibiting the Wnt signaling pathway.
25955299 blockade of CD82 in leukemia cells lowered EZH2 expression via activation of p38 MAPK signaling.
25912735 CD82 down-regulation could be a critical step involved in the EGFR over-expression and the stronger tumorigenic activity triggered by EGFR mutations
More...

AA Sequence

MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMG      1 - 70
FLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAW     71 - 140
DYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWP    141 - 210
VYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY                 211 - 267
//

Text Mined References (151)

PMID Year Title
26681053 2015 Expression levels of survivin, Bcl-2, and KAI1 proteins in cervical cancer and their correlation with metastasis.
26408312 2015 Evaluation of the correlation of KAI1/CD82, CD44, MMP7 and ?-catenin in the prediction of prognosis and metastasis in colorectal carcinoma.
26335499 2015 Tetraspanin CD82: a suppressor of solid tumors and a modulator of membrane heterogeneity.
26260387 2015 The novel function of CD82 and its impact on BCL2L12 via AKT/STAT5 signal pathway in acute myelogenous leukemia cells.
26246476 2015 Loss of tumor suppressors KAI1 and p27 identifies a unique subgroup of primary melanoma patients with poor prognosis.
26231404 2015 Clinicopathological significance of KAI1 expression and epithelial-mesenchymal transition in non-small cell lung cancer.
26199094 2015 The role of the metastasis suppressor gene KAI1 in melanoma angiogenesis.
26132195 2015 miR-203 Inhibits Frizzled-2 Expression via CD82/KAI1 Expression in Human Lung Carcinoma Cells.
25955299 2015 Tetraspanin Family Member, CD82, Regulates Expression of EZH2 via Inactivation of p38 MAPK Signaling in Leukemia Cells.
25912735 2015 EGFR over-expression in non-small cell lung cancers harboring EGFR mutations is associated with marked down-regulation of CD82.
More...