Property Summary

NCBI Gene PubMed Count 474
Grant Count 336
R01 Count 193
Funding $33,047,396.76
PubMed Score 2815.08
PubTator Score 1193.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.760 0.002
Multiple myeloma 1.567 0.001
oligodendroglioma 1.100 0.020
sonic hedgehog group medulloblastoma 1.600 0.000
astrocytoma 1.200 0.011
glioblastoma 1.200 0.006
atypical teratoid / rhabdoid tumor 1.100 0.000
medulloblastoma, large-cell 1.400 0.000
lung cancer 1.900 0.000
lung adenocarcinoma 1.196 0.000
ovarian cancer 1.800 0.001

Synonym

Accession P27695 Q969L5 Q99775
Symbols APE
APX
APE1
APEN
APEX
HAP1
REF1

Gene

PDB

1BIX   1CQG   1CQH   1DE8   1DE9   1DEW   1E9N   1HD7   2ISI   2O3H   3U8U   4IEM   4LND   4QH9   4QHD   4QHE   5CFG   5DFF   5DFH   5DFI   5DFJ   5DG0  

Gene RIF (451)

PMID Text
27057081 Study shows that APE1/Ref-1 levels were significantly elevated in bladder cancer (BCa) patients relative to levels in non-BCa controls and were correlated with tumor grade and stage. These results suggest that APE1 would be a good biomarker for diagnosis of BCa.
26811994 XPC interacts physically with APE1 and XPC regulates APE1 expression.
26761793 Our results implicate APE1 in novel molecular interactions that regulate early stress responses elicited by microbial infections.
26624999 a possible role of APE1/Ref-1 over-expression both in hepatocyte survival and HCC development
26539816 reduced activity in Alzheimer disease
26520369 Results show that APE1 plays an important role in temozolomide resistance of glioblastoma cells. Its down-regulation sensitizes the cells to the cytotoxic effects of temozolomide.
26373042 variant alleles in the NEIL2 (rs804270), APE1 (rs2275008), CYP2E1 (rs2031920) and MDM2 (rs2279744) SNPs may independently influence susceptibility to gastric cancer in a Northern Jiangsu Chinese population.
26359670 Extreme expression of APE1 in malignant tumors was observed, suggesting that breast cancer cells may require APE1 for survival.
26314200 Findings indicated that individuals with APEX1 variant TG genotypes had a significant decreased risk of breast cancer, however, the significant association between 1349T>G polymorphism and breast cancer risk was not observed.
26292623 results of this meta-analysis collectively suggest that APE1 gene Asp148Glu variant is not a risk-conferring factor for digestive cancer. Further large and well-designed studies are required
More...

AA Sequence

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVD      1 - 70
GLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPL     71 - 140
KVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGD    141 - 210
LNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGW    211 - 280
RLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL                                    281 - 318
//

Text Mined References (487)

PMID Year Title
27057081 2016 Urinary APE1/Ref-1: A Potential Bladder Cancer Biomarker.
26811994 XPC deficiency is related to APE1 and OGG1 expression and function.
26761793 2016 Regulation of Rac1 and Reactive Oxygen Species Production in Response to Infection of Gastrointestinal Epithelia.
26624999 2015 Transcriptional Up-Regulation of APE1/Ref-1 in Hepatic Tumor: Role in Hepatocytes Resistance to Oxidative Stress and Apoptosis.
26539816 2015 Defective mitochondrial respiration, altered dNTP pools and reduced AP endonuclease 1 activity in peripheral blood mononuclear cells of Alzheimer's disease patients.
26520369 2015 APE1/REF-1 down-regulation enhances the cytotoxic effects of temozolomide in a resistant glioblastoma cell line.
26373042 2015 Polymorphisms in NEIL-2, APE-1, CYP2E1 and MDM2 Genes are Independent Predictors of Gastric Cancer Risk in a Northern Jiangsu Population (China).
26359670 2015 Extreme Expression of DNA Repair Protein Apurinic/Apyrimidinic Endonuclease 1 (APE1) in Human Breast Cancer As Measured by Liquid Chromatography and Isotope Dilution Tandem Mass Spectrometry.
26314200 2015 The association of ApE1 -656T>G and 1349T>G polymorphisms with breast cancer susceptibility in northern Iran.
26292623 2015 Association of APE1 Gene Asp148Glu Variant with Digestive Cancer: A Meta-Analysis.
More...