Property Summary

NCBI Gene PubMed Count 166
PubMed Score 281.88
PubTator Score 385.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Chloracne 32
Disease Target Count P-value
glioblastoma multiforme 347 8.54070874827032E-18
posterior fossa group A ependymoma 1511 4.19451859431824E-9
malignant mesothelioma 3163 6.38515273997124E-6
atypical teratoid/rhabdoid tumor 1095 6.59433351940908E-6
dermatomyositis 967 2.05327384183497E-4
psoriasis 6685 2.70646113460083E-4
ovarian cancer 8492 0.00117917285789692
group 3 medulloblastoma 2254 0.00204484619517204
Waldenstrons macroglobulinemia 765 0.00441705468046263
chronic lymphocytic leukemia 244 0.00444492068236412
astrocytoma 1493 0.00663225119770207
Breast cancer 3099 0.0289400369541329

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.757 0.004
chronic lymphocytic leukemia 1.484 0.004
malignant mesothelioma 1.200 0.000
psoriasis 1.500 0.000
glioblastoma multiforme 1.100 0.000
posterior fossa group A ependymoma 1.400 0.000
astrocytoma 1.900 0.007
atypical teratoid/rhabdoid tumor 1.500 0.000
Breast cancer 2.800 0.029
group 3 medulloblastoma 1.400 0.002
ovarian cancer -1.400 0.001
dermatomyositis 1.500 0.000

Synonym

Accession P27694 A8K0Y9 Q59ES9 RP-A p70
Symbols HSSB
RF-A
RP-A
REPA1
RPA70
MST075

Gene

PDB

4NB3   2B3G   1EWI   1FGU   1JMC   1L1O   2B29   4IJH   4IJL   4IPC   4IPD   4IPG   4IPH   4LUO   4LUV   4LUZ   4LW1   4LWC   4O0A   4R4C   4R4I   4R4O   4R4Q   4R4T   5E7N   5EAY  

  Ortholog (16)

 GWAS Trait (1)

Gene RIF (115)

PMID Text
26824734 radiation induced the excessive expression RPA1 in TE-1 cells, and the radiosensitivity of TE-1R cells was less than that of TE-1 cells
26782416 Our study predicted that UBC and RPA had potential as target genes for the diagnosis and treatment of osteosarcoma
26474068 RFWD3-dependent ubiquitination of RPA regulates repair at stalled replication forks.
26366868 a significant increase in DKC1, RAD50, MRE11 and RPA1 expression in MM cases with high bone marrow infiltration (p</=0.03) and a tendency towards cases with advanced ISS stage
26145171 by targeting RPA and mimicking DNA, DSS1 functions with BRCA2 in a two-component homologous recombination mediator complex in genome maintenance and tumor suppression
26041456 The D228Y mutation in human RPA1 affects its DNA-binding activity to telomeric DNA.
25922199 FAN1 efficiently promoted DNA incision at the proper site of RPA-coated 5'-flapped DNA. Therefore, FAN1 possesses the ability to promote the ICL repair of 5'-flapped DNA covered by RPA.
25542993 Here, we introduce a number of key characteristics and concepts, including the modularity of the proteins, linkage of weak binding sites, direct competition between sites, and allostery, using the protein replication protein A (RPA). [review]
25453469 RPA70 is an intrinsically highly dynamic single-stranded DNA-binding complex during both replication and distinct steps of nucleotide excision repair.
25400143 RPA plays an important maintaining genome integrity. [Review]
More...

AA Sequence

MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQ      1 - 70
LSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASS     71 - 140
RPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIR    141 - 210
TWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTF    211 - 280
NNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMD    281 - 350
TSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ    351 - 420
ALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKV    421 - 490
IDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEE    491 - 560
VFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM                  561 - 616
//

Text Mined References (186)

PMID Year Title
26824734 2015 RPA1 expression in esophageal carcinoma and its influence on radiosensitivity of esophageal carcinoma TE-1 cells.
26782416 2015 Selecting key genes associated with osteosarcoma based on a differential expression network.
26774285 2016 HELB Is a Feedback Inhibitor of DNA End Resection.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26474068 2015 RFWD3-Dependent Ubiquitination of RPA Regulates Repair at Stalled Replication Forks.
26366868 2015 Differential Expression of Non-Shelterin Genes Associated with High Telomerase Levels and Telomere Shortening in Plasma Cell Disorders.
26145171 2015 Promotion of BRCA2-Dependent Homologous Recombination by DSS1 via RPA Targeting and DNA Mimicry.
26041456 2015 RPA prevents G-rich structure formation at lagging-strand telomeres to allow maintenance of chromosome ends.
25922199 2015 Human FAN1 promotes strand incision in 5'-flapped DNA complexed with RPA.
25542993 2015 Characteristics and concepts of dynamic hub proteins in DNA processing machinery from studies of RPA.
More...