Property Summary

Ligand Count 42
NCBI Gene PubMed Count 195
PubMed Score 297.92
PubTator Score 385.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.900 6.6e-03
atypical teratoid / rhabdoid tumor 1.400 2.2e-04
Breast cancer 2.800 2.9e-02
Chronic Lymphocytic Leukemia 1.484 4.4e-03
dermatomyositis 1.500 2.1e-04
ependymoma 1.300 1.8e-11
glioblastoma multiforme 1.100 8.5e-18
group 3 medulloblastoma 1.100 1.4e-02
malignant mesothelioma 1.200 6.4e-06
ovarian cancer -1.400 1.2e-03
psoriasis 1.500 2.7e-04
Waldenstrons macroglobulinemia 1.757 4.4e-03

Protein-protein Interaction (3)

Gene RIF (135)

AA Sequence

MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQ      1 - 70
LSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASS     71 - 140
RPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIR    141 - 210
TWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTF    211 - 280
NNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMD    281 - 350
TSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ    351 - 420
ALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKV    421 - 490
IDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEE    491 - 560
VFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM                  561 - 616
//

Text Mined References (215)

PMID Year Title