Property Summary

NCBI Gene PubMed Count 166
Grant Count 32
R01 Count 19
Funding $2,779,788.83
PubMed Score 281.88
PubTator Score 385.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.757 0.004
Chronic Lymphocytic Leukemia 1.484 0.004
malignant mesothelioma 1.200 0.000
psoriasis 1.500 0.000
glioblastoma multiforme 1.100 0.000
posterior fossa group A ependymoma 1.400 0.000
astrocytoma 1.900 0.007
atypical teratoid/rhabdoid tumor 1.500 0.000
Breast cancer 2.800 0.029
group 3 medulloblastoma 1.400 0.002
ovarian cancer -1.400 0.001
dermatomyositis 1.500 0.000

 GWAS Trait (1)

Gene RIF (115)

PMID Text
26824734 radiation induced the excessive expression RPA1 in TE-1 cells, and the radiosensitivity of TE-1R cells was less than that of TE-1 cells
26782416 Our study predicted that UBC and RPA had potential as target genes for the diagnosis and treatment of osteosarcoma
26474068 RFWD3-dependent ubiquitination of RPA regulates repair at stalled replication forks.
26366868 a significant increase in DKC1, RAD50, MRE11 and RPA1 expression in MM cases with high bone marrow infiltration (p</=0.03) and a tendency towards cases with advanced ISS stage
26145171 by targeting RPA and mimicking DNA, DSS1 functions with BRCA2 in a two-component homologous recombination mediator complex in genome maintenance and tumor suppression
26041456 The D228Y mutation in human RPA1 affects its DNA-binding activity to telomeric DNA.
25922199 FAN1 efficiently promoted DNA incision at the proper site of RPA-coated 5'-flapped DNA. Therefore, FAN1 possesses the ability to promote the ICL repair of 5'-flapped DNA covered by RPA.
25542993 Here, we introduce a number of key characteristics and concepts, including the modularity of the proteins, linkage of weak binding sites, direct competition between sites, and allostery, using the protein replication protein A (RPA). [review]
25453469 RPA70 is an intrinsically highly dynamic single-stranded DNA-binding complex during both replication and distinct steps of nucleotide excision repair.
25400143 RPA plays an important maintaining genome integrity. [Review]
More...

AA Sequence

MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQ      1 - 70
LSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASS     71 - 140
RPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIR    141 - 210
TWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTF    211 - 280
NNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMD    281 - 350
TSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ    351 - 420
ALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKV    421 - 490
IDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEE    491 - 560
VFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM                  561 - 616
//

Text Mined References (186)

PMID Year Title
26824734 2015 RPA1 expression in esophageal carcinoma and its influence on radiosensitivity of esophageal carcinoma TE-1 cells.
26782416 2015 Selecting key genes associated with osteosarcoma based on a differential expression network.
26774285 2016 HELB Is a Feedback Inhibitor of DNA End Resection.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26474068 2015 RFWD3-Dependent Ubiquitination of RPA Regulates Repair at Stalled Replication Forks.
26366868 2015 Differential Expression of Non-Shelterin Genes Associated with High Telomerase Levels and Telomere Shortening in Plasma Cell Disorders.
26145171 2015 Promotion of BRCA2-Dependent Homologous Recombination by DSS1 via RPA Targeting and DNA Mimicry.
26041456 2015 RPA prevents G-rich structure formation at lagging-strand telomeres to allow maintenance of chromosome ends.
25922199 2015 Human FAN1 promotes strand incision in 5'-flapped DNA complexed with RPA.
25542993 2015 Characteristics and concepts of dynamic hub proteins in DNA processing machinery from studies of RPA.
More...