Property Summary

NCBI Gene PubMed Count 39
PubMed Score 16.57
PubTator Score 16.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Congenital Abnormalities 11 0.0 0.0
Disease Target Count
Congenital Abnormality 11
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Age related macular degeneration 72 3.594 1.8
Disease Target Count Z-score Confidence
Fuchs' endothelial dystrophy 24 4.661 2.3

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.598 1.2e-02
adult high grade glioma 1.400 8.7e-03
Astrocytoma, Pilocytic 1.500 7.1e-05
autosomal dominant Emery-Dreifuss muscul... 1.013 1.9e-03
Breast cancer 4.500 2.2e-02
breast carcinoma 1.400 5.8e-03
cystic fibrosis -2.086 2.0e-05
ependymoma 1.100 3.0e-02
gastric carcinoma 4.600 5.5e-03
Gaucher disease type 3 -1.500 4.6e-02
glioblastoma 1.600 2.5e-02
Hydrolethalus syndrome 1.813 3.2e-02
intraductal papillary-mucinous adenoma (... -2.800 2.0e-02
invasive ductal carcinoma 4.852 1.2e-06
lung cancer -1.400 2.6e-04
lung carcinoma -2.400 8.8e-25
malignant mesothelioma -1.300 7.6e-06
nasopharyngeal carcinoma 1.800 8.0e-04
ovarian cancer -5.000 2.0e-07
pancreatic cancer 1.100 1.2e-02
pituitary cancer -1.900 2.9e-03
primary pancreatic ductal adenocarcinoma 4.091 1.8e-04
psoriasis -1.700 3.4e-08
subependymal giant cell astrocytoma 3.441 4.6e-02
ulcerative colitis 1.500 2.5e-02
urothelial carcinoma 2.400 3.6e-02

 MGI Phenotype (1)

Gene RIF (13)

AA Sequence

MAVLPGPLQLLGVLLTISLSSIRLIQAGAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPHMPLAKDGLAM      1 - 70
GKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGH     71 - 140
GIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGEIGQKGEIGPMGIPGPQGPPGPHGLPGIGKP    141 - 210
GGPGLPGQPGPKGDRGPKGLPGPQGLRGPKGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFP    211 - 280
GPQGPLGKPGAPGEPGPQGPIGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGI    281 - 350
GKPGFPGPKGDRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVG    351 - 420
PQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGD    421 - 490
QGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPG    491 - 560
PPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVG    561 - 630
APVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQA    631 - 700
SGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM                              701 - 744
//

Text Mined References (46)

PMID Year Title